Align phosphopentomutase (EC 5.4.2.7) (characterized)
to candidate WP_007508193.1 R2APBS1_RS10425 phosphoglucosamine mutase
Query= BRENDA::Q6I7B6 (450 letters) >NCBI__GCF_000230695.2:WP_007508193.1 Length = 450 Score = 132 bits (331), Expect = 3e-35 Identities = 128/462 (27%), Positives = 209/462 (45%), Gaps = 46/462 (9%) Query: 2 RLFGTAGIRGTLWE-KVTPELAMKVGMAVGTY------KSGKALVGRDGRTSSVMLKNAM 54 + FGT GIRG + + ++ + +K+G AVG+ K L+G+D R S M + A+ Sbjct: 5 KYFGTDGIRGLVGQWPISADFMLKLGRAVGSVLAREGTKRPNVLIGKDTRISGYMFEAAL 64 Query: 55 ISGLLSTGMEVLDADLIPTPALAWGTRKL-ADAGVMITASHNPPTDNGVKVFNGDGTEFY 113 +GL++ G +V +PTPA+A+ TR + A G++I+ASHNP DNG+K F+ DG + Sbjct: 65 EAGLVAAGADVDLLGPMPTPAVAYLTRSMRAQTGIVISASHNPHHDNGIKFFSADGEKLS 124 Query: 114 VEQERGLEE-------IIFSGNFRKARWDEIKPVRNVEVIPDYINAVLDFVGHETNLKVL 166 E E +E + S KAR + R E + DF H L+++ Sbjct: 125 DEVELAIEREVDAAFVTVPSEQLGKARRLDDAAARYAEYCKSTVAE--DFSLH--GLRLV 180 Query: 167 YDGANGAGSLVAPYLLREMGAKVLSVNAHVDGHFPGRKPEPRYENIAYLGKLVRELGVDL 226 D A+GA VAP + E+GA+V+++ DG R+ + L + V G DL Sbjct: 181 LDCAHGATYQVAPKVFAELGAEVVAIGDKPDGFNINREVGSTHPQA--LQQAVLAHGADL 238 Query: 227 AIAQDGDADRIAVFDEKGNYVDEDTVIALFAKLYVEEHG-GGTVVVSIDTGSRIDAVVER 285 IA DGD DR+ + D G D D ++ L A+ + + G VV ++ + + + Sbjct: 239 GIAFDGDGDRVQLVDRLGVLADGDDILYLLARSWQAQGKLHGPVVGTLMSNYGLQLALAG 298 Query: 286 AGGRVVRIPLGQPH--DGIKRYKAIFAAEPWK----LVHPKFGPWI-DPFVTMGLLIKLI 338 +VR +G + +K++ + E L G I + L++ Sbjct: 299 LDVPLVRANVGDRYVLQQLKQHGGVLGGETSGHILCLDRATTGDGIIAALAVLEALVRSG 358 Query: 339 DENGPLSELVKEIPTYYLKKANVLCPDEYKAEVVRRAAEEVERKLSSEIKEVLTISGFRI 398 ++ + ++++P L V + ++ VR+A EVE+ L + VL Sbjct: 359 EDLAAARQGLRKMPQVMLNVRAVGAREALASDQVRQALAEVEQVLHGRGRVVL------- 411 Query: 399 ALNDGSWILIRPSGTEPKIRVVAEAPTEKRRDELFEMAYSTV 440 R SGTEP +RV E +L E TV Sbjct: 412 ----------RASGTEPLVRVTIEGADAAEVQQLAERLAGTV 443 Lambda K H 0.318 0.138 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 464 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 450 Length of database: 450 Length adjustment: 33 Effective length of query: 417 Effective length of database: 417 Effective search space: 173889 Effective search space used: 173889 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory