Align alcohol dehydrogenase (cytochrome c) (EC 1.1.2.8) (characterized)
to candidate WP_015446406.1 R2APBS1_RS00405 cytochrome c
Query= BRENDA::C7G3B8 (472 letters) >NCBI__GCF_000230695.2:WP_015446406.1 Length = 463 Score = 280 bits (716), Expect = 7e-80 Identities = 167/433 (38%), Positives = 234/433 (54%), Gaps = 27/433 (6%) Query: 11 GAVAVGLLAGTSLAHAQNADEDLIKKGEYVARLGDCVACHTSLNGQKYAGGLSIKTPIGT 70 G + + LL S A D L+++G+Y+A GDCVACHT+ G+ YAGGL++ TP+G Sbjct: 7 GRLLLALLVTASAHAADTTDTTLLQRGQYLATAGDCVACHTAPGGKPYAGGLTVPTPVGN 66 Query: 71 IYSTNITPDPTYGIGTYTFKEFDEAVRHGVRKDGATLYPAMPYPSFARMTQDDMKALYAY 130 I STNITP T GIG YT +F +A+R G+R DGA LYPAMPY S+A++T DD++ALYAY Sbjct: 67 IISTNITPSTTAGIGRYTEPQFRDALRKGIRADGAHLYPAMPYTSYAQVTDDDVRALYAY 126 Query: 131 FMHGAQPIAQKNHPTDISWPMSMRWPLSIWRSVFAPAPKDFTPAPGTDAEIARGEYLVTG 190 FMHG + + T + +P ++R ++ W +F K FTP P DA+ RG YLV G Sbjct: 127 FMHGVASVDNRPALTRLPFPFNLRLSMAGWNLLFLDR-KPFTPDPAKDAKWNRGAYLVRG 185 Query: 191 PGHCGACHTPRGFGMQEKALDASGGPDFLGGGGVIDNWIAPSLRNDPVLGLGRWSDEDLF 250 HC CHTPR M E++ GG++ +W+AP++ D G+G WS++DL Sbjct: 186 LAHCSTCHTPRNLLMAERSSREL-------AGGMVGSWLAPNITADANSGIGGWSEQDLV 238 Query: 251 LFLKSGRTDHSA-AFGGMADVVGWSTQYFTDADLHAMVKYIKSLP---PVPPARGDYSYD 306 +L+ G A A G MA+ V S Q+F ADL A+ Y+K++P R + Sbjct: 239 DYLQLGHARGKAQAAGPMAEAVEHSLQHFEPADLQAIASYLKTVPARHDPADTRAVGGWG 298 Query: 307 ASTAQMLDSNNISGNA------GAKTYVDQCAICHRNDG-GGVARMFPPLAGNPVVVSDN 359 A+ M D I+ A G + Y CA CH+ G G PPL N Sbjct: 299 AAFDGMADQRGIAPPADAEQWSGEQLYDAHCASCHQAGGEGSFDGGLPPLFHNTATGRVA 358 Query: 360 PTSVAHIVVDGGVLPPTNW--APSAVAMPDYKNILSDQQIADVVNFIRSAWGNRAPANTT 417 ++ ++++G W S V MP + LSDQQIA + N++ +GN A A T Sbjct: 359 SGNLVLVILEG-----IRWQTGDSGVHMPGFAGDLSDQQIATLGNYLTLRYGNPA-ARIT 412 Query: 418 AADIQKLRLDHTP 430 A + LR P Sbjct: 413 ATRVANLRAGGAP 425 Lambda K H 0.318 0.135 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 708 Number of extensions: 45 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 472 Length of database: 463 Length adjustment: 33 Effective length of query: 439 Effective length of database: 430 Effective search space: 188770 Effective search space used: 188770 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory