Align histidine transport ATP-binding protein hisP (characterized)
to candidate WP_015448118.1 R2APBS1_RS12060 ABC transporter ATP-binding protein
Query= CharProtDB::CH_003210 (257 letters) >NCBI__GCF_000230695.2:WP_015448118.1 Length = 255 Score = 140 bits (354), Expect = 2e-38 Identities = 90/249 (36%), Positives = 135/249 (54%), Gaps = 21/249 (8%) Query: 8 VIDLHKRYGEHEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSEGSIVVNGQ 67 ++ KRYG + L+ VSL AG ++IGSSGSGKST LR + LE P G + V+G+ Sbjct: 14 LVQAGKRYGRLQALEQVSLAFAAGTTTALIGSSGSGKSTVLRLLLGLEWPDHGHVEVDGR 73 Query: 68 TINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKQE 127 + ++ + LR R+ V Q L+ H+T L N+ P + LG +++ Sbjct: 74 PLQ-------------RSDVLPLRRRVGYVIQDGGLFPHLTALGNLALLP-RHLGWNRER 119 Query: 128 ARERAVKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPEVLLFDEPTSALDP-- 185 R+RA + A + +YP LSGGQ+QRV++ RAL +P+ LL DEP ALDP Sbjct: 120 IRQRAEQLAALTHLPTGVLERYPAELSGGQRQRVALMRALMADPDALLLDEPLGALDPVV 179 Query: 186 --ELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSTHVIFLHQGKIEEEGAPEQLFGNP 243 EL E+ +I QL GKT++VVTH++ A + ++ L QG + ++G L P Sbjct: 180 RHELQDELKQIFDQL---GKTVIVVTHDLAEAAWFAERLVLLRQGAVLQDGTFRDLRERP 236 Query: 244 QSPRLQRFL 252 + RF+ Sbjct: 237 ADAFVNRFV 245 Lambda K H 0.318 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 255 Length adjustment: 24 Effective length of query: 233 Effective length of database: 231 Effective search space: 53823 Effective search space used: 53823 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory