Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate WP_041677064.1 R2APBS1_RS14330 ABC transporter ATP-binding protein
Query= uniprot:D8IUY7 (241 letters) >NCBI__GCF_000230695.2:WP_041677064.1 Length = 307 Score = 100 bits (250), Expect = 3e-26 Identities = 67/223 (30%), Positives = 118/223 (52%), Gaps = 7/223 (3%) Query: 6 LKVQQLSVAYGGIQAVKGIDLEVNEGELVTLIGANGAGKTTTLKAITGTLPASRVEGHIE 65 ++ + L+ +G + AV +DLEV + +G NG+GK+TT++ + G L S EG IE Sbjct: 1 MRARGLTRRFGKLVAVDHVDLEVPARRVYGFLGPNGSGKSTTIRMLCGLLTPS--EGEIE 58 Query: 66 YLGQPLKGKKSFELVKDKLAMVPEGRGVFTRMSIQENL-LMGAYTSDDKGQIAADIDKWF 124 LG L+ + ++ + + + +F + ++ENL + A K + ID+ Sbjct: 59 VLG--LRVPAQADALRPHIGYMTQNFSLFEDLGVRENLEFLAAIQGVPKAKTRRRIDELI 116 Query: 125 AVFPRLKERAAQMAGTLSGGEQQMLAMARALMSHPKLLLLDEPSMGLSPIMVEKIFEVIR 184 + +R Q+AGTLSGG++Q LA+A A++ P+LLLLDEP+ + P +E + Sbjct: 117 GQY-HFGDRQKQLAGTLSGGQKQRLALAGAVIHEPELLLLDEPTSAVDPESRRDFWEKLF 175 Query: 185 NVSAQGITILLVEQNAKLALEAAHRGYVMESGLITMQGQAQQM 227 ++ G T LLV + E HR +++ G++ G ++ Sbjct: 176 ELADIG-TTLLVSTHLMDEAERCHRLAILDRGVLVADGTPHEL 217 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 241 Length of database: 307 Length adjustment: 25 Effective length of query: 216 Effective length of database: 282 Effective search space: 60912 Effective search space used: 60912 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory