Align phosphopentomutase (EC 5.4.2.7) (characterized)
to candidate WP_015449135.1 R2APBS1_RS18720 phosphomannomutase/phosphoglucomutase
Query= BRENDA::Q6I7B6 (450 letters) >NCBI__GCF_000230695.2:WP_015449135.1 Length = 770 Score = 157 bits (396), Expect = 1e-42 Identities = 136/452 (30%), Positives = 203/452 (44%), Gaps = 34/452 (7%) Query: 3 LFGTAGIRGTLWEKVTPELAMKVGMAVGTYKSGKAL----VGRDGRTSSVMLKNAMISGL 58 +F +RG + + + E+A +G ++GT K L VGRDGR S L A+ GL Sbjct: 317 IFRAYDVRGVVGKTLNKEVAHALGQSIGTLMVEKGLREIVVGRDGRLSGPELAAALADGL 376 Query: 59 LSTGMEVLDADLIPTPALAWGTRKL-ADAGVMITASHNPPTDNGVKVFNGDGTEFYVEQE 117 G++V+D +PTP + + T + GV +T SHNPP NG K+ G G Sbjct: 377 REAGVDVIDIGAVPTPVVYYATYRFNTGCGVAVTGSHNPPDYNGFKIVVG-GQTLAEGAI 435 Query: 118 RGLEEIIFSGNFRKARWDEIKPVRNVEVIPDYINAVLDFVGHETNLKVLYDGANGAGSLV 177 + L + I G + R V+V PDYI ++ V E LKV+ D NG + Sbjct: 436 QDLYQRIAGGALASGGGGGL---RQVDVAPDYIEKIIADVLAERRLKVVVDCGNGIPGAI 492 Query: 178 APYLLREMGAKVLSVNAHVDGHFPGRKPEPR-YENIAYLGKLVRELGVDLAIAQDGDADR 236 AP +L +G +V+ + VDG FP P+P N+ L VR+ G DL +A DGD DR Sbjct: 493 APQVLEGVGCEVVPLYCDVDGSFPNHHPDPSDPHNLEDLIIAVRQTGADLGLAFDGDGDR 552 Query: 237 IAVFDEKGNYVDEDTVIALFAKLYVEEHGGGTVVVSIDTGSRIDAVVERAGGRVVRIPLG 296 + V G V D ++ LFA+ + G TV+ + S + + AGG + G Sbjct: 553 LGVVTRSGEIVYPDRLLMLFARDVLSRQPGATVIYDVKCTSHLKGQILDAGGSPLMWRTG 612 Query: 297 QPHDGIKRYKAIFAAEPWKLVHPKF---GPWI---DPFVTMGLLIKLI--DENGPLSELV 348 H IK AE + F W D L++++ D G +E + Sbjct: 613 --HSLIKAKMRETQAELAGEMSGHFFFKERWYGFDDGIYAAARLLEILAGDLQGRSAEQI 670 Query: 349 KEIPTYYLKKANVLCPDEYKAEVVR----RAAEEVERKLSSEIKEVLTISGFRIALNDGS 404 + + E K E+ R +++ ++ S E ++TI G R DG Sbjct: 671 ------FATLPKSVSTPELKVELAEGEHYRFMDQLRQQASFEDASLITIDGVRADWPDG- 723 Query: 405 WILIRPSGTEP--KIRVVAEAPTE-KRRDELF 433 W L+R S T P +R A+ P KR +LF Sbjct: 724 WGLVRASNTTPVLVLRFEADDPVALKRIQQLF 755 Lambda K H 0.318 0.138 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 809 Number of extensions: 63 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 450 Length of database: 770 Length adjustment: 37 Effective length of query: 413 Effective length of database: 733 Effective search space: 302729 Effective search space used: 302729 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory