GapMind for catabolism of small carbon sources

 

Alignments for a candidate for nbaF in Rhodanobacter denitrificans 2APBS1

Align 2-aminomuconate deaminase; EC 3.5.99.5 (characterized)
to candidate WP_015447194.1 R2APBS1_RS05720 2-aminomuconate deaminase

Query= SwissProt::Q9KWS2
         (142 letters)



>NCBI__GCF_000230695.2:WP_015447194.1
          Length = 143

 Score = 97.1 bits (240), Expect = 1e-25
 Identities = 54/127 (42%), Positives = 79/127 (62%), Gaps = 4/127 (3%)

Query: 18  PMGSFPHVKRAGDFLFVSGTSSRRP-DNTFVGAEPDDTGRPRP-NIELQTREVISNIRDI 75
           P+G++PH +R G+ LF+SG   R+P  N   G   D  GR    +IE Q R+V +N+R +
Sbjct: 14  PVGAYPHARRVGNLLFLSGVGPRQPGSNAIPGNVHDADGRLAGYDIEAQCRQVFANVRAV 73

Query: 76  LQSVGADLGDVVEVCSYLVNMN-DFAAYNKVYAEFFDATGPARTTVAVHQLPHPQLVIEI 134
           L++ GA   D+V+V  +L +M  DFAAYN++YAE+F      RTTV +  LP P + IE+
Sbjct: 74  LEASGARWEDLVDVTVFLTDMQRDFAAYNRLYAEYFAGVDACRTTVGIDALPTP-IAIEL 132

Query: 135 KVVAYKP 141
           K +A  P
Sbjct: 133 KCIAALP 139


Lambda     K      H
   0.318    0.135    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 62
Number of extensions: 4
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 142
Length of database: 143
Length adjustment: 16
Effective length of query: 126
Effective length of database: 127
Effective search space:    16002
Effective search space used:    16002
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 42 (20.8 bits)

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory