Align GlcT, component of Glucose, mannose, galactose porter (characterized)
to candidate WP_014268863.1 SPIGRAPES_RS00735 sugar ABC transporter permease
Query= TCDB::Q97UZ0 (286 letters) >NCBI__GCF_000236685.1:WP_014268863.1 Length = 289 Score = 116 bits (291), Expect = 5e-31 Identities = 84/267 (31%), Positives = 138/267 (51%), Gaps = 9/267 (3%) Query: 15 IFSAILLYLVIWNAVMSFMNWSLLNSKPTFVGLETYSIVIRTFQFTNSLLHSIELSVILV 74 +F L IW +SF W+ + KPT VGLE Y ++++ F + L++I V V Sbjct: 21 LFLVFQLIPTIWTIAISFTEWNGIG-KPTVVGLENYLMMLKDQMFIEAFLNTIVYWVTAV 79 Query: 75 VIGNILGIFIAALLYFLNSNKARSTFLSIVIYPLSISMAVNGLIWLWLFNIHIG-VDWLL 133 L I I LL N K++S F +I P + GLI+ LF+ ++G V+ + Sbjct: 80 FFILSLSILIGMLLTSSNL-KSKSFFKTITFLPNVCAGIAMGLIFRMLFDENVGLVNEIF 138 Query: 134 VRIGLPQFPWLSSTSTMFPSLVLVSVWAYTGIAALFYLAGFMNIDKTIVEAARLDGTSAF 193 V +G + PWL+STS ++++++W T + ++G +NI K EAAR+DG F Sbjct: 139 VALGFGRLPWLTSTSMSKIPVIILNIWRNTPWFTMIIISGLLNISKDYYEAARVDGAGIF 198 Query: 194 KILYKILIPNSLNSFIIATALLFLFSFRIFDLPYVLSG-GTTNIFLQTSELYMYYL-FTV 251 + + I +P+ N L + S++IF+ P++L G GT+N L YMY FT+ Sbjct: 199 RQFFYITLPSLGNILFFCFITLTVDSWKIFNEPFILPGPGTSNTSLFQ---YMYQNGFTI 255 Query: 252 EYFSQATAVATMITLIAT-IIIIPYAL 277 + A+ ++ LI I +I +A+ Sbjct: 256 FKMGYSAAIGCILILILLGISLIQFAV 282 Lambda K H 0.331 0.142 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 238 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 286 Length of database: 289 Length adjustment: 26 Effective length of query: 260 Effective length of database: 263 Effective search space: 68380 Effective search space used: 68380 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory