Align Benzoate--CoA ligase; Benzoyl-CoA synthetase; EC 6.2.1.25 (characterized)
to candidate WP_009154395.1 SACMADRAFT_RS13570 AMP-binding protein
Query= SwissProt::Q8GQN9 (527 letters) >NCBI__GCF_000244955.1:WP_009154395.1 Length = 571 Score = 174 bits (440), Expect = 1e-47 Identities = 152/488 (31%), Positives = 242/488 (49%), Gaps = 25/488 (5%) Query: 48 GSYTYDELALRVNRCGSALRTTLGLQPKDRVLVCVLDGIDFPTTFLGAIKGGVVPIAINT 107 G +T+ EL+ R ++ + LR G++ DR+++ + + ++ T L A K G V I +T Sbjct: 74 GRWTFPELSRRSSQVANWLRQR-GVRRGDRLILMLGNQVELWETILAAAKLGAVIIPAST 132 Query: 108 LLTESDYEYMLTDSAARVAVVSQELLPLFAPMLGKVPTLEHLVVAGG---AGEDSLAALL 164 LL +D + AR V+ FA + G ++ +A G +G S AA Sbjct: 133 LLGPADLRDRVDRGDARHVVIRSADTEKFAEVPG-----DYTRIAVGEPVSGWHSFAAAY 187 Query: 165 ATGSEQFEAAPTRPDDHCFWLYSSGSTGAPKGTVHIHSD--LIHTAELYARPILGIREGD 222 + + PT DD ++SG+T PK H H + H + +Y LG+ GD Sbjct: 188 SADAAFSPDGPTGADDPLLLYFTSGTTAKPKLVQHTHVSYPVGHLSTMYW---LGLEPGD 244 Query: 223 VVFSAAKLFFAYGLGNGLIFPLAVGATAVLMAERPTPA-AVFERLRRHQPDIFYGVPTLY 281 V + + +A + + P AT L A A+ +L R F PT++ Sbjct: 245 VHLNISSPGWAKHAWSNVFAPWNAEATVFLYNYTRFDADALMAQLDRCGVTSFCAPPTVW 304 Query: 282 ASML-ANPDCPKEGELRLRACTSAGEALPEDVGRRWQARFGVDILDGIGSTEMLHIFLSN 340 ++ A+ ++ ++ AGE L +V + + +GV I DG G TE + ++N Sbjct: 305 RMLIQADLSALRKPPTKV---VGAGEPLNPEVIEQVRKSWGVTIRDGFGQTET-SVQIAN 360 Query: 341 RAGD-VHYGTSGKPVPGYRLRLIDEDGAEITTAG-VAGELQISGPSSAVMYWNNPEKTAA 398 G V G+ G+ VPG+R+ L+D E ++ G + +L Y ++ E+TA Sbjct: 361 TPGQPVKPGSMGRAVPGFRVVLLDPVSGEPSSEGEICLDLTHRPVGLMAGYADDDERTAT 420 Query: 399 TFMGEWTRSGDKYLVNDEGYYVYAGRSDDMLKVSGIYVSPIEVESALIAHEAVLEAAVVG 458 F G + +GD +++ GY Y GR+DD+ K S +SP E+ES L+ H AV EAAVV Sbjct: 421 AFAGGYYHTGDVGSIDENGYITYVGRTDDVFKASDYRISPFELESVLLEHPAVAEAAVVP 480 Query: 459 WEDEDHLIKPKAFIVLKPGY-GAGEALRTDLKAHVKNLLAPYKYPRWIEFVDDLPKTATG 517 D L PKA++VL G+ +GE + L+ +N LAPYK R ++F DLPKT +G Sbjct: 481 SPDPIRLAVPKAYVVLAAGHEPSGETAESILRFCRQN-LAPYKRIRRLQFA-DLPKTISG 538 Query: 518 KIQRFKLR 525 KI+R +LR Sbjct: 539 KIRRVELR 546 Lambda K H 0.319 0.138 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 767 Number of extensions: 52 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 527 Length of database: 571 Length adjustment: 36 Effective length of query: 491 Effective length of database: 535 Effective search space: 262685 Effective search space used: 262685 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory