Align glyoxylate reductase (EC 1.1.1.26); 4-hydroxybutyrate dehydrogenase (EC 1.1.1.61); glyoxylate reductase (NADP+) (EC 1.1.1.79) (characterized)
to candidate WP_009154695.1 SACMADRAFT_RS15065 NAD(P)-dependent oxidoreductase
Query= BRENDA::Q9LSV0 (289 letters) >NCBI__GCF_000244955.1:WP_009154695.1 Length = 300 Score = 134 bits (337), Expect = 2e-36 Identities = 84/285 (29%), Positives = 133/285 (46%) Query: 1 MEVGFLGLGIMGKAMSMNLLKNGFKVTVWNRTLSKCDELVEHGASVCESPAEVIKKCKYT 60 + +GF GLG+MG+ M++NL + G + VWNRT ++CD +V GA E+ + Sbjct: 6 VRLGFAGLGVMGQPMALNLARAGLPLVVWNRTAARCDPVVAEGACRAADARELFELADVV 65 Query: 61 IAMLSDPCAALSVVFDKGGVLEQICEGKGYIDMSTVDAETSLKINEAITGKGGRFVEGPV 120 + ML+D A +V+ G+ + M TV + S ++ IT GG +VE PV Sbjct: 66 LLMLADEAAVDAVLARGTAGFGPRVRGRTVVHMGTVSSGYSSELAADITEAGGAYVEAPV 125 Query: 121 SGSKKPAEDGQLIILAAGDKALFEESIPAFDVLGKRSFYLGQVGNGAKMKLIVNMIMGSM 180 SGS+ PA GQL+ + AG A P L +F G V MK VN+ + +M Sbjct: 126 SGSRGPARAGQLVAMLAGHDADVARVRPLLAPLCSATFDCGAVPGALLMKFAVNLFLITM 185 Query: 181 MNAFSEGLVLADKSGLSSDTLLDILDLGAMTNPMFKGKGPSMNKSSYPPAFPLKHQQKDM 240 + +E A L L ILD G M + + + K + + + K+ Sbjct: 186 VTGLTEAFHFAQGHRLDLSALERILDAGPMASTVSRTKAGKLVAGDFSVQASISDVLKNA 245 Query: 241 RLALALGDENAVSMPVAAAANEAFKKARSLGLGDLDFSAVIEAVK 285 RL ++ P+ + + + LG G+LD +AV+ AV+ Sbjct: 246 RLIAESARAAGLAAPLLEVCHALYGETADLGHGELDMAAVLRAVQ 290 Lambda K H 0.317 0.134 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 300 Length adjustment: 26 Effective length of query: 263 Effective length of database: 274 Effective search space: 72062 Effective search space used: 72062 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory