Align Fructokinase (EC 2.7.1.4) (characterized)
to candidate WP_009155646.1 SACMADRAFT_RS19930 sugar kinase
Query= reanno::Dyella79:N515DRAFT_1919 (326 letters) >NCBI__GCF_000244955.1:WP_009155646.1 Length = 314 Score = 105 bits (261), Expect = 2e-27 Identities = 102/322 (31%), Positives = 144/322 (44%), Gaps = 24/322 (7%) Query: 3 RNILCFGEALIDFHAEGRDAQGFPRSFIPFAGGAPANVSVAVARLGGPAAFAGMLGQDMF 62 R ++ FGE+L F + + + AG + A V++ VARLG PA++AG +G D Sbjct: 4 RGLVTFGESLAVFSTQSGKLRHAGSVDVGIAG-SEAIVAIGVARLGVPASWAGRVGADEP 62 Query: 63 GDFLLDSLRRAGVDTAGVARTGEANTALAFVALDSHGERSFSFYRPPSADLLFRPEHFRA 122 G +L LR GVDT+ A T L + ++YR SA PE Sbjct: 63 GALVLLRLRDEGVDTSAAMTDQHAPTGLMLKDFRTTDATRCAYYRNGSAGTRLCPEDIPE 122 Query: 123 ESFRGAAVFHV--CSNSMTEPALAEATREGMRRAHTAGAWVSFDLNLRPALWPNQSASHD 180 + R A V H+ + S+++ A A+A + A G VSFD+N R ALW Q A+ Sbjct: 123 DRIRQAGVLHLSGLTPSLSDTA-AKAVLAAVEVAREEGVPVSFDVNYRNALWEPQEAT-G 180 Query: 181 ELWPALHLADVVKLSAEEFHWLAGDEGEEATLDRLWAGRARL----LVVTDGSRTLRWFH 236 L + AD+V S +E L G GE ++L A A L ++V G R Sbjct: 181 VLLDLVSRADIVFASVDEAAPL-GFTGEPVRPEQLLAYLAELGPEQVIVKLGPRGALAEL 239 Query: 237 PDASGEMPVYAVPTVDSTAAGDAFVGGLLHRLATVEKGADQLDHLVAELPRLHAMLRFAA 296 ++P Y V +DS A DAFV G L D L P +R AA Sbjct: 240 HGCRYDVPTYPVRAIDSEGADDAFVAGYL------------ADFLAGAPP--DRRVRTAA 285 Query: 297 ACGALTVTRLGSFAAMPDEAEV 318 AC A V+ G + +PD E+ Sbjct: 286 ACRAFAVSVHGDWEGLPDREEL 307 Lambda K H 0.322 0.135 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 297 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 326 Length of database: 314 Length adjustment: 28 Effective length of query: 298 Effective length of database: 286 Effective search space: 85228 Effective search space used: 85228 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory