Align Fructokinase (EC 2.7.1.4) (characterized)
to candidate WP_083841078.1 SACMADRAFT_RS29575 ribokinase
Query= reanno::Dino:3609413 (308 letters) >NCBI__GCF_000244955.1:WP_083841078.1 Length = 452 Score = 105 bits (263), Expect = 2e-27 Identities = 101/315 (32%), Positives = 141/315 (44%), Gaps = 51/315 (16%) Query: 2 ILCAGEALIDMLPRA--LPDGT-----AGFAPVAGGAVFNTAVALGRLGADVGLVTGLSR 54 +L G A +D++ A P G A + GG NTAVA RLGADV LV + Sbjct: 168 VLVVGSANVDLVVEAERRPAGGETVLGADTVVLPGGKGANTAVAAARLGADVALVGAVGD 227 Query: 55 DLFGEVLMTALAAADVDSDMAVLSDRPTTLAFVTLT-DGHAQYAFYDENTAGRMLAPADM 113 D FG +L+ +L A+ +D DRPT +A++T+T DG EN+ +++P Sbjct: 228 DGFGRLLLESLRASGTRTDHVRTVDRPTGVAYITVTPDG--------ENSI--LVSPGAN 277 Query: 114 PDPGPEVGTLFFGGISLAVE----PCAAAYEALCLKAAAGRVVMLDPNIRPGFIKDETTF 169 PE T G S+ V P AL AG +L N+ P Sbjct: 278 RALCPEAVTAALPGASVLVASLEVPVPTVEHALAAAEEAGVRTVL--NLSP--------V 327 Query: 170 RARIDRMLAVTDIVKVSDEDLAWLMGPGDLAESAAALR--ARGPAVVCVTRGGAGVEAHT 227 +R L D++ V+ + AWL+G AES A R GP VT+G +G T Sbjct: 328 AEIAERALNGLDVLLVNQHEAAWLLG----AESVEATRLLELGPKAAVVTKGPSGAVVVT 383 Query: 228 ATGITHVAAEAVEVVDTVGAGDTFNAGFLAGLAEAGALDKDRLRALDAPVLTSALRLGAQ 287 G + + A V+ VDT GAGD F F LA ++ A TSA+R+ Sbjct: 384 GAGSSEIPAPEVDAVDTTGAGDAFAGAFATALARGASI---------ADAATSAVRV--- 431 Query: 288 AAAITVSRAGANPPW 302 A ++V R GA P + Sbjct: 432 -ATMSVLRRGAQPSY 445 Lambda K H 0.320 0.136 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 302 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 452 Length adjustment: 30 Effective length of query: 278 Effective length of database: 422 Effective search space: 117316 Effective search space used: 117316 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory