Align Polyphosphate glucokinase; Poly(P) glucokinase; ATP-dependent glucokinase; Polyphosphate--glucose phosphotransferase; EC 2.7.1.63; EC 2.7.1.2 (characterized)
to candidate WP_009153912.1 SACMADRAFT_RS11125 ROK family protein
Query= SwissProt::A5U654 (265 letters) >NCBI__GCF_000244955.1:WP_009153912.1 Length = 253 Score = 307 bits (787), Expect = 1e-88 Identities = 147/252 (58%), Positives = 189/252 (75%), Gaps = 2/252 (0%) Query: 16 TQRHGFGIDVGGSGIKGGIVDLDTGQLIGDRIKLLTPQPATPLAVAKTIAEVVNGFGWRG 75 T GFGID+GGSGIKG +VDL G+LIGDR+++ TP+PATP A+A + E+V+ FGW G Sbjct: 2 TATRGFGIDIGGSGIKGAVVDLKEGRLIGDRLRIDTPRPATPDAIADVVTEIVDHFGWDG 61 Query: 76 PLGVTYPGVVTHGVVRTAANVDKSWIGTNARDTIGAELGGQ--QVTILNDADAAGLAETR 133 P+G+T P V+ GV +TAAN+D +WIGT+A LG V +LNDADAAG+AETR Sbjct: 62 PVGITLPAVIKKGVAQTAANIDPAWIGTDADAMFAERLGRTVADVAMLNDADAAGMAETR 121 Query: 134 YGAGKNNPGLVVLLTFGTGIGSAVIHNGTLIPNTEFGHLEVGGKEAEERAASSVKEKNDW 193 +G+ + G+V LLTFGTGIGSA+ H+ LIPNTEFGHLE+ G +AE+RAA+SVK+ Sbjct: 122 FGSPRARQGVVALLTFGTGIGSALFHDAKLIPNTEFGHLEIDGYDAEKRAAASVKDNEGL 181 Query: 194 TYPKWAKQVIRVLIAIENAIWPDLFIAGGGISRKADKWVPLLENRTPVVPAALQNTAGIV 253 +YP+WAK+V R L +EN IWPDLF+ GGG+S+K++KWVPLL RTPV A+LQN AGIV Sbjct: 182 SYPEWAKRVDRYLTVLENLIWPDLFVVGGGVSKKSEKWVPLLRVRTPVEVASLQNNAGIV 241 Query: 254 GAAMASVADTTH 265 GAA A+ H Sbjct: 242 GAAAAAAEGIEH 253 Lambda K H 0.314 0.134 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 265 Length of database: 253 Length adjustment: 24 Effective length of query: 241 Effective length of database: 229 Effective search space: 55189 Effective search space used: 55189 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory