Align butanoyl-CoA dehydrogenase (NAD+, ferredoxin) (subunit 1/3) (EC 1.3.1.109) (characterized)
to candidate WP_009153576.1 SACMADRAFT_RS09425 electron transfer flavoprotein subunit alpha/FixB family protein
Query= BRENDA::Q18AQ5 (336 letters) >NCBI__GCF_000244955.1:WP_009153576.1 Length = 321 Score = 167 bits (424), Expect = 3e-46 Identities = 117/326 (35%), Positives = 167/326 (51%), Gaps = 14/326 (4%) Query: 3 NVLVVIEQRENVIQTVSLELLGKATEIAKDYDTKVSALLLGSKVEGLIDTLAHYGADEVI 62 NVLV+ E + S ELLGKA E+A + K L G L+ + GAD V+ Sbjct: 4 NVLVLAEHIGGQLSESSYELLGKAKELAAAWGGKAEVALFGPS--DLVSQVE--GADVVV 59 Query: 63 VVDDEALAVYTTEPYTKAAYEAIKAADPIVVLFGATSIGRDLAPRVSARIHTGLTADCTG 122 +D ALA YT E Y A + P +VL ++G DL +S L A Sbjct: 60 SMDHPALADYTCEGYETALLSVLAERAPRLVLLSNATVGLDLGAALSVLWDAPLAAYVGD 119 Query: 123 LAVAEDTKLLLMTRPAFGGNIMATIVCKDFRPQMSTVRPGVMKK---NEPDETKEAVINR 179 L DT + T GG +MA + R + TV G P ++E V Sbjct: 120 LRAEGDTPVA--TCQVMGGKVMAEVELAGERG-ICTVLAGAFPAAAGQAPAVSQEVVTAA 176 Query: 180 FKVEFNDADKL-VQVVQVIKEAKKQVKIEDAKILVSAGRGMGGKENLDILYELAEIIGGE 238 E +KL + + +VI+ V I DA++LVS GRG+ ++NL+++ ELA+ +G Sbjct: 177 APDEL---EKLRMSLARVIEPEGGDVNITDAELLVSVGRGIDSQDNLELVQELADALGAP 233 Query: 239 VSGSRATIDAGWLDKARQVGQTGKTVRPDLYIACGISGAIQHIAGMEDAEFIVAINKNPE 298 +S SR ID+GWL K RQVG++G V+P Y+A GISGA +H+ GM DAE I+A N + Sbjct: 234 LSASRPVIDSGWLPKTRQVGKSGLKVKPKAYLAFGISGAPEHLEGMRDAELIIACNTDEN 293 Query: 299 APIFKYADVGIVGDVHKVLPELISQL 324 APIF A G D+ ++P L+ ++ Sbjct: 294 APIFDVAHYGSAEDLFDLVPALVDKI 319 Lambda K H 0.316 0.135 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 276 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 321 Length adjustment: 28 Effective length of query: 308 Effective length of database: 293 Effective search space: 90244 Effective search space used: 90244 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory