Align ribokinase (EC 2.7.1.15) (characterized)
to candidate WP_083841078.1 SACMADRAFT_RS29575 ribokinase
Query= BRENDA::Q8NQR0 (307 letters) >NCBI__GCF_000244955.1:WP_083841078.1 Length = 452 Score = 219 bits (557), Expect = 1e-61 Identities = 130/299 (43%), Positives = 172/299 (57%), Gaps = 15/299 (5%) Query: 2 SNSTGTDIVVVGSINADLTAKVQRHPEPGETLLGSGGTVSAGGKGANQAVAAAQLGAKVT 61 + S ++VVGS N DL + +R P GET+LG+ V GGKGAN AVAAA+LGA V Sbjct: 161 AGSVAARVLVVGSANVDLVVEAERRPAGGETVLGADTVVLPGGKGANTAVAAARLGADVA 220 Query: 62 MIGAVGTDQMAGEALTHLRQSGADMSAIATVDGPTGLAIITVSDDGENTIIVIPGANASV 121 ++GAVG D L LR SG + TVD PTG+A ITV+ DGEN+I+V PGAN ++ Sbjct: 221 LVGAVGDDGFGRLLLESLRASGTRTDHVRTVDRPTGVAYITVTPDGENSILVSPGANRAL 280 Query: 122 TAEFVDKHSQLIENAGIVLLQGEIPADGFERAVDLSQG---RVVINLAPVVPVGHDQLRR 178 E V + + A +++ E+P E A+ ++ R V+NL+PV + L Sbjct: 281 CPEAV---TAALPGASVLVASLEVPVPTVEHALAAAEEAGVRTVLNLSPVAEIAERALNG 337 Query: 179 ADPLLVNEHEGALVLDMLGTPATTSDPQSLVTELLEQGFTSVVMTLGAEGALVGTPGQLT 238 D LLVN+HE A +L A T LLE G + V+T G GA+V T + Sbjct: 338 LDVLLVNQHEAAWLLGAESVEA---------TRLLELGPKAAVVTKGPSGAVVVTGAGSS 388 Query: 239 AIPTPKIQAVDTTGSGDAFAGALVAKLSEGAGLIEAATFAARVGAYAATRPGAQASYPT 297 IP P++ AVDTTG+GDAFAGA L+ GA + +AAT A RV + R GAQ SYPT Sbjct: 389 EIPAPEVDAVDTTGAGDAFAGAFATALARGASIADAATSAVRVATMSVLRRGAQPSYPT 447 Lambda K H 0.312 0.130 0.357 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 383 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 452 Length adjustment: 30 Effective length of query: 277 Effective length of database: 422 Effective search space: 116894 Effective search space used: 116894 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory