GapMind for catabolism of small carbon sources

 

Protein WP_008538996.1 in Megamonas funiformis YIT 11815

Annotation: NCBI__GCF_000245775.1:WP_008538996.1

Length: 271 amino acids

Source: GCF_000245775.1 in NCBI

Candidate for 11 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-mannose catabolism manZ hi PTS system mannose-specific EIID component; EII-M-Man; EIID-Man; Mannose permease IID component (characterized) 69% 96% 396.7 PTFD aka LEVG, component of Fructose group translocator, LevDEFG 59% 344.4
D-cellobiose catabolism manZ med PTS system mannose-specific EIID component; EII-M-Man; EIID-Man; Mannose permease IID component (characterized) 69% 96% 396.7 Lmo0781 protein, component of Constitutively synthesized sensor, MpoABCD, controlling man operon (see TC# 4.A.6.1.15) expression by interacting with and phosphorylating ManR, the transcriptional regulator of the man operon 68% 388.7
D-fructose catabolism levG med PTND aka MANZ aka PTSM aka GPTB aka B1819, component of The mannose (glucose, 2-deoxyglucose, glucosamine, N-acetylglucosamine, N-acetylmannosamine, mannosamine and fructose) PTS porter/group translocator, ManXYZ (Rephaeli and Saier 1980; Plumbridge 2015). Catalyzes xylose facilitated diffusion in lactobacilli. The order of D-sugar substrate affinities is: glucose > mannose > 2-deoxyglucose > N-acetylglucosamine > glucosamine > N-acetylmannosamine > mannosamine > fructose (characterized) 69% 95% 396.7 Lmo0781 protein, component of Constitutively synthesized sensor, MpoABCD, controlling man operon (see TC# 4.A.6.1.15) expression by interacting with and phosphorylating ManR, the transcriptional regulator of the man operon 68% 388.7
D-glucosamine (chitosamine) catabolism manZ med PTS system mannose-specific EIID component; EII-M-Man; EIID-Man; Mannose permease IID component (characterized) 69% 96% 396.7 Lmo0781 protein, component of Constitutively synthesized sensor, MpoABCD, controlling man operon (see TC# 4.A.6.1.15) expression by interacting with and phosphorylating ManR, the transcriptional regulator of the man operon 68% 388.7
D-glucose catabolism manZ med PTS system mannose-specific EIID component; EII-M-Man; EIID-Man; Mannose permease IID component (characterized) 69% 96% 396.7 Lmo0781 protein, component of Constitutively synthesized sensor, MpoABCD, controlling man operon (see TC# 4.A.6.1.15) expression by interacting with and phosphorylating ManR, the transcriptional regulator of the man operon 68% 388.7
lactose catabolism manZ med PTS system mannose-specific EIID component; EII-M-Man; EIID-Man; Mannose permease IID component (characterized) 69% 96% 396.7 Lmo0781 protein, component of Constitutively synthesized sensor, MpoABCD, controlling man operon (see TC# 4.A.6.1.15) expression by interacting with and phosphorylating ManR, the transcriptional regulator of the man operon 68% 388.7
D-maltose catabolism manZ med PTS system mannose-specific EIID component; EII-M-Man; EIID-Man; Mannose permease IID component (characterized) 69% 96% 396.7 Lmo0781 protein, component of Constitutively synthesized sensor, MpoABCD, controlling man operon (see TC# 4.A.6.1.15) expression by interacting with and phosphorylating ManR, the transcriptional regulator of the man operon 68% 388.7
sucrose catabolism levG med PTND aka MANZ aka PTSM aka GPTB aka B1819, component of The mannose (glucose, 2-deoxyglucose, glucosamine, N-acetylglucosamine, N-acetylmannosamine, mannosamine and fructose) PTS porter/group translocator, ManXYZ (Rephaeli and Saier 1980; Plumbridge 2015). Catalyzes xylose facilitated diffusion in lactobacilli. The order of D-sugar substrate affinities is: glucose > mannose > 2-deoxyglucose > N-acetylglucosamine > glucosamine > N-acetylmannosamine > mannosamine > fructose (characterized) 69% 95% 396.7 Lmo0781 protein, component of Constitutively synthesized sensor, MpoABCD, controlling man operon (see TC# 4.A.6.1.15) expression by interacting with and phosphorylating ManR, the transcriptional regulator of the man operon 68% 388.7
sucrose catabolism manZ med PTS system mannose-specific EIID component; EII-M-Man; EIID-Man; Mannose permease IID component (characterized) 69% 96% 396.7 Lmo0781 protein, component of Constitutively synthesized sensor, MpoABCD, controlling man operon (see TC# 4.A.6.1.15) expression by interacting with and phosphorylating ManR, the transcriptional regulator of the man operon 68% 388.7
trehalose catabolism manZ med PTS system mannose-specific EIID component; EII-M-Man; EIID-Man; Mannose permease IID component (characterized) 69% 96% 396.7 Lmo0781 protein, component of Constitutively synthesized sensor, MpoABCD, controlling man operon (see TC# 4.A.6.1.15) expression by interacting with and phosphorylating ManR, the transcriptional regulator of the man operon 68% 388.7
D-gluconate catabolism gntEIID lo PTS system, IID component, component of The gluconate PTS uptake system. IIAGnt and IIBGnt form a high affinity 2:2 heterotetrameric complex (characterized) 33% 94% 124 PTS system mannose-specific EIID component; EII-M-Man; EIID-Man; Mannose permease IID component 69% 396.7

Sequence Analysis Tools

View WP_008538996.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MKKLSSNDLFWTFIRSNFLQGSWNMERMQALGFCFGMVPIIKKLYEGEERKQAIKRHLEF
YNTQPFVTAPIIGVVAAMEEQKANGKDIQDGVINGIKVGMMGPLAGVGDPIFWGTLRPIC
AALGASLAMGGSLLGPILFFVLFNVVRLLIRWYGIKYGYTKGTDIIQDVAGNTLQKITEG
ASILGLFVMGALVNKWTTVNIPVVISEVTMQDGSVVTTTVQSILDQLMPGLIPLLLTFLC
MKLMKKKVNAIWIIFGLFAVGIIGYGLGILK

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory