Align hexokinase (EC 2.7.1.1) (characterized)
to candidate WP_008539359.1 HMPREF9454_RS09110 hexokinase
Query= BRENDA::Q09756 (484 letters) >NCBI__GCF_000245775.1:WP_008539359.1 Length = 427 Score = 217 bits (552), Expect = 7e-61 Identities = 156/456 (34%), Positives = 227/456 (49%), Gaps = 47/456 (10%) Query: 24 NKTLQDHLDELEEQFTIPTELLHRVTDRFVSELYKGLT-TNPGDVPMVPTWIIGTPDGNE 82 NK Q+ +DE FT+ ++ + V F ++ G+ T + M+P++I G P G E Sbjct: 3 NKKFQEMIDE----FTLDSDAIKDVAASFRYDIEHGVKETGESSLRMLPSYI-GLPTGKE 57 Query: 83 HGSYLALDLGGTNLRVCAVEVQGNGKFDITQSKYR---LPQELKVGTREA----LFDYIA 135 G YLALD GGTNLRV + + G GKF++ + + +P E +A LFD+IA Sbjct: 58 TGEYLALDFGGTNLRVVLIRLDGEGKFEVIKKVAKPLVVPGEYDFICADANADELFDFIA 117 Query: 136 DCIKKFVEEVHPGKSQNLEIGFTFSYPCVQRSINDASLVAWTKGFDIDGVEGESVGPLLS 195 D I+ E V + + +G TFS+P Q +I +A L+ WTK F GVEGE V LL Sbjct: 118 DMIE---EAVDGNRDKKYLLGHTFSFPSSQTNIYNARLIIWTKEFATKGVEGEVVNDLLK 174 Query: 196 AALKRVGCNNVRLNAILSDTTGTLVASNYASPGTEIGVIFGTGCNACYIEKFSEIPKLHK 255 AAL R NV A+++DT L+A+ Y IG I+ TG N CY E F+ + K Sbjct: 175 AALARKNLTNVEPTAVINDTVAVLLAAAYKLGNVNIGSIYATGHNTCYYETFTGMGK--- 231 Query: 256 YDFPEDMNMIINCEWCDFDNQHVVLPRTKYDVAIDEESPRPGLQTYEKMIAGCYLGDILR 315 M+IN E F+ L KYD +D ES + Q EKM++G Y+G++L Sbjct: 232 ------PAMVINMESGGFNK----LAINKYDYKLDMESEKQYEQRLEKMVSGRYMGELLS 281 Query: 316 RILLDLYEQGALFNGQDVTKIRDPLAMDTSVLSAIEVDPFENLDETQTLFEETYGLKTTE 375 L D + G + + T I +S I D ++LD L + T Sbjct: 282 YCLDDAWNIGKV----EFTSID---------ISTILADNSDSLDGVCDLLKAKTNADITT 328 Query: 376 EERQFIRRACELIGTRSARLSACGVCALVRKM----NKPSMIVGTDGSVYNLYPRFKDRL 431 ++ +++ E I +RSARL C ++ + P V DGSVY P KD + Sbjct: 329 DDAIWVKALAETIASRSARLVVATYCGIMWHLYPNGGIPKQFVAVDGSVYEKMPTIKDNM 388 Query: 432 AQAFKDILGEEIGSKVVTIPAEDGSGVGAALVSALE 467 +A +ILGEE K+ + GS +GAAL +A+E Sbjct: 389 QKAIYEILGEE-ADKLELVLENGGSALGAALAAAME 423 Lambda K H 0.318 0.137 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 457 Number of extensions: 30 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 484 Length of database: 427 Length adjustment: 33 Effective length of query: 451 Effective length of database: 394 Effective search space: 177694 Effective search space used: 177694 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory