Align 2-Deoxy-D-ribose porter, DeoP (characterized)
to candidate WP_008537873.1 HMPREF9454_RS03085 L-fucose:H+ symporter permease
Query= TCDB::Q8XEV7 (438 letters) >NCBI__GCF_000245775.1:WP_008537873.1 Length = 447 Score = 218 bits (555), Expect = 3e-61 Identities = 133/414 (32%), Positives = 225/414 (54%), Gaps = 21/414 (5%) Query: 2 NDKNIVQMPDGYLNKTPLFQFILLSCLFPLWGCAAALNDILITQFKSVFSLSNFASALVQ 61 N +I +P Y ++ F+L+SC F LWG + D L+ F +F + S+LVQ Sbjct: 16 NSSSIPVVPAQYR----IYFFLLVSC-FALWGLLNNMTDNLVPSFAKIFMIKAVDSSLVQ 70 Query: 62 SAFYGGYFLIAIPASLVIKKTSYKVAILIGLTLYIVGCTLFFPASHMATYTMFLAAIFAI 121 AFYG Y ++A+PA+ +IKK SY+V +L+GL Y++G + PA+ + +Y +FL +IF + Sbjct: 71 VAFYGAYAVLAMPAAFIIKKYSYRVGVLVGLGFYMIGAFGYIPAAILQSYNLFLVSIFIL 130 Query: 122 AIGLSFLETAANTYSSMIGPKAYATLRLNISQTFYPIGAAAGILLGKYLVFS--EGESLE 179 A GLS LET N + +G + + RLN +Q F P+G+ AG+ L KY++ + L+ Sbjct: 131 AGGLSVLETTCNPFVLSLGAQETSVRRLNFAQAFNPVGSMAGLFLAKYIILANLNPADLD 190 Query: 180 KQMAGMNAEQVHNFKVLMLENTLEPYKYMIMVLVVVMVLFLLTRF--PTCKVAQTASHKR 237 ++A M+ ++ + L PY +I++ ++ V+F ++ +VA T Sbjct: 191 DRLA-MSPAELSAIRDTELFWVCVPYVGLILIAFIIWVIFFRSKLNDKDGRVAMTV---- 245 Query: 238 PSALDTLRYLASNARFRRGIVAQFLYVGMQVAVWSFTIRLALELGDINERDASTFMVYSF 297 P A L N R+ G++ QF YVG+Q+AVW++TI+ + +I E DA + +Y+ Sbjct: 246 PQAFGK---LLQNPRYYWGVITQFFYVGVQIAVWTWTIKYIMATKNIIEADAVNYYIYAM 302 Query: 298 ACFFIGKFIANILMTRFNPEKVLILYSVIGALFLAYVALAPSFSAVYVAVLVSVLFGPCW 357 F +++ LM F P K++ ++++ G L P+ +VY + +S + Sbjct: 303 VLFIACRWLCTYLMKYFVPAKMMAIFALGGILCCLGTIYLPTSVSVYCLIAISGCMSLMF 362 Query: 358 ATIYAGTLDTVDNEHTEMAGAVIVMAIVGAAVVPAIQGYVADMFHSLQLSFLVS 411 TIY L + E + A ++MAI+G A++ I G++ D S LSF+VS Sbjct: 363 PTIYGIALRGLGAE-VKFGAAGLIMAILGGAIITPIMGWLVD---SSALSFMVS 412 Lambda K H 0.329 0.139 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 458 Number of extensions: 25 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 438 Length of database: 447 Length adjustment: 32 Effective length of query: 406 Effective length of database: 415 Effective search space: 168490 Effective search space used: 168490 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory