Align PTS system, IIB component, component of The gluconate PTS uptake system. IIAGnt and IIBGnt form a high affinity 2:2 heterotetrameric complex (characterized)
to candidate WP_008538998.1 HMPREF9454_RS07875 PTS transporter subunit IIB
Query= TCDB::Q82ZC7 (168 letters) >NCBI__GCF_000245775.1:WP_008538998.1 Length = 158 Score = 77.4 bits (189), Expect = 1e-19 Identities = 48/158 (30%), Positives = 90/158 (56%), Gaps = 5/158 (3%) Query: 6 LARVDERLIHGQVMVTLSQKSGVNSIFVVDEVVAKDKFMRDLYKSAGSRTGQKTIVITPE 65 LAR+D+RLIHGQV ++ +G I V D+ VA D L K + G K+ V++ + Sbjct: 5 LARIDDRLIHGQVATVWAKVTGCERIIVCDDDVASDTIRATLLKQV-APPGIKSSVVSVD 63 Query: 66 KAKFYWDEYQFKEYNCILIAKTVSVIYDLVKHGVPMKELNIGGIAQKNPEKDLLVTKSVY 125 KA ++ +++ C+L+ + + +V+ GV +K +N+GG++ K ++ +T +V Sbjct: 64 KAIRVYNNPKYENDKCLLLFTNPTSVLRMVEGGVDIKSVNVGGMSFKEGKRQ--ITNAVS 121 Query: 126 LNKEDAEKLKELHEVYGVEDIYFQATPSAPKTSLKEVL 163 ++ +D E K+L E G+E I F+ + + +L E++ Sbjct: 122 VDDKDVESFKKLSE-KGIE-IEFRKVDTDKRVNLMEII 157 Lambda K H 0.317 0.135 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 70 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 168 Length of database: 158 Length adjustment: 18 Effective length of query: 150 Effective length of database: 140 Effective search space: 21000 Effective search space used: 21000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory