Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate WP_008537164.1 HMPREF9454_RS00035 methionine ABC transporter ATP-binding protein
Query= BRENDA::Q97UY8 (353 letters) >NCBI__GCF_000245775.1:WP_008537164.1 Length = 353 Score = 151 bits (382), Expect = 2e-41 Identities = 82/231 (35%), Positives = 141/231 (61%), Gaps = 2/231 (0%) Query: 4 IIVKNVSKVFK--KGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGE 61 I +KN+ K + G V AL ++N+ I+ GE +GI+G SGAGK+T +R I L+ P++G Sbjct: 2 IKLKNIVKTYDTPNGSVHALKDINLEIKRGEIYGIIGLSGAGKSTLVRCINMLERPTSGN 61 Query: 62 LYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRV 121 + + + + + + + + IGM+FQ + L T ++NIAFPL SKEEI+ +V Sbjct: 62 VIVNGKDLTTMTESQLREARKDIGMIFQHFNLLSTSTVYDNIAFPLKLAGKSKEEIKAKV 121 Query: 122 EEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARA 181 E + K++ + + + +P +LSGGQ+QRV +ARAL D +LL DE S LD + + Sbjct: 122 EPLLKLVGLENKAHQYPSQLSGGQKQRVGIARALANDTKVLLCDEATSALDPQTTKAILE 181 Query: 182 LVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNP 232 L++++ +L +T++V++H+ I + D+V VL G + + G +++ NP Sbjct: 182 LIRDINKKLQLTVVVITHEMQVIKDLCDKVAVLDHGVIAENGTVLEIFTNP 232 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 306 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 353 Length adjustment: 29 Effective length of query: 324 Effective length of database: 324 Effective search space: 104976 Effective search space used: 104976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory