Align PTS system mannose-specific EIID component; EII-M-Man; EIID-Man; Mannose permease IID component (characterized)
to candidate WP_008538996.1 HMPREF9454_RS07865 PTS mannose transporter subunit IID
Query= SwissProt::P69805 (283 letters) >NCBI__GCF_000245775.1:WP_008538996.1 Length = 271 Score = 395 bits (1016), Expect = e-115 Identities = 188/271 (69%), Positives = 224/271 (82%), Gaps = 2/271 (0%) Query: 11 KKLTQSDIRGVFLRSNLFQGSWNFERMQALGFCFSMVPAIRRLYPENNEARKQAIRRHLE 70 KKL+ +D+ F+RSN QGSWN ERMQALGFCF MVP I++LY E RKQAI+RHLE Sbjct: 2 KKLSSNDLFWTFIRSNFLQGSWNMERMQALGFCFGMVPIIKKLY--EGEERKQAIKRHLE 59 Query: 71 FFNTQPFVAAPILGVTLALEEQRANGAEIDDGAINGIKVGLMGPLAGVGDPIFWGTVRPV 130 F+NTQPFV API+GV A+EEQ+ANG +I DG INGIKVG+MGPLAGVGDPIFWGT+RP+ Sbjct: 60 FYNTQPFVTAPIIGVVAAMEEQKANGKDIQDGVINGIKVGMMGPLAGVGDPIFWGTLRPI 119 Query: 131 FAALGAGIAMSGSLLGPLLFFILFNLVRLATRYYGVAYGYSKGIDIVKDMGGGFLQKLTE 190 AALGA +AM GSLLGP+LFF+LFN+VRL R+YG+ YGY+KG DI++D+ G LQK+TE Sbjct: 120 CAALGASLAMGGSLLGPILFFVLFNVVRLLIRWYGIKYGYTKGTDIIQDVAGNTLQKITE 179 Query: 191 GASILGLFVMGALVNKWTHVNIPLVVSRITDQTGKEHVTTVQTILDQLMPGLVPLLLTFA 250 GASILGLFVMGALVNKWT VNIP+V+S +T Q G TTVQ+ILDQLMPGL+PLLLTF Sbjct: 180 GASILGLFVMGALVNKWTTVNIPVVISEVTMQDGSVVTTTVQSILDQLMPGLIPLLLTFL 239 Query: 251 CMWLLRKKVNPLWIIVGFFVIGIAGYACGLL 281 CM L++KKVN +WII G F +GI GY G+L Sbjct: 240 CMKLMKKKVNAIWIIFGLFAVGIIGYGLGIL 270 Lambda K H 0.326 0.143 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 332 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 283 Length of database: 271 Length adjustment: 25 Effective length of query: 258 Effective length of database: 246 Effective search space: 63468 Effective search space used: 63468 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory