Align PTS system, mannose/fructose/sorbose family, IID component, component of The primary glucose /mannose uptake transporter, ManLMN (characterized)
to candidate WP_008539788.1 HMPREF9454_RS10755 PTS system mannose/fructose/sorbose family transporter subunit IID
Query= TCDB::E1UCI2 (303 letters) >NCBI__GCF_000245775.1:WP_008539788.1 Length = 278 Score = 147 bits (372), Expect = 2e-40 Identities = 88/279 (31%), Positives = 147/279 (52%), Gaps = 36/279 (12%) Query: 26 WNYERMQNGGWAFSMIPAIKKLYKTKEDRSSALKRHLEFFNTHPYIASPILGVTLALEEE 85 ++ E MQ G+ +M+P I++LYKTKE++ A++ + FFNT P + S ++G+T +LEE Sbjct: 25 FSQEHMQTFGYLCAMLPIIEELYKTKEEQKKAMQTYTAFFNTEPQVGSVVVGITASLEEA 84 Query: 86 RANGAE-VDDVAIQGVKVGMMGPLAGVGDPVFWFTIRPMLGALGASLALSGNILGPILFF 144 +ANGA+ ++ I G++ G+MGPLAG+GD + T+ P+L + L+ G+ +G I + Sbjct: 85 KANGADDINAETINGLRAGLMGPLAGIGDSLVVGTLIPILLGIAMGLSTGGSPIGAIFYI 144 Query: 145 VAWN-VIRWGFMWYTQEFGYKAGSKITDDLSGGLLQDITKGASILGMFVLAALVQRWVNI 203 + WN +I WG M + GY+ G K D L G I + +LG V+ A+ W+NI Sbjct: 145 IVWNLLITWG-MRFLYFKGYELGGKAIDFLVGERATAIRESIVMLGTIVIGAVAGTWINI 203 Query: 204 QFAPIISKVKLDEGAYIDWSHLPQGAQGIKTALEQQQAGLALSEIKVTTLQNNLDNLIPG 263 + + A+G ++ LQ+ L+ + P Sbjct: 204 R------------------TGFTMTAEG--------------ADKPFLVLQDTLNGVFPN 231 Query: 264 LAAVALTFLCMWLL-KKKISPIIIILGLFVVGIVGHLIG 301 + + C +LL K+ +SPI ++L L V+ VG L+G Sbjct: 232 ILSAVFVIFCWYLLTKRNMSPIYVMLLLVVIAFVGVLVG 270 Lambda K H 0.323 0.140 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 216 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 278 Length adjustment: 26 Effective length of query: 277 Effective length of database: 252 Effective search space: 69804 Effective search space used: 69804 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory