Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate WP_008540147.1 HMPREF9454_RS12055 hydroxyacid dehydrogenase
Query= BRENDA::Q9I530 (329 letters) >NCBI__GCF_000245775.1:WP_008540147.1 Length = 326 Score = 133 bits (334), Expect = 7e-36 Identities = 82/261 (31%), Positives = 136/261 (52%), Gaps = 16/261 (6%) Query: 70 RLVALRSAGYNHVDLAAAEALGLPVVHVPAYSPHAVAEHAVGLILTLNRRLHRAYNRTRE 129 +++ G + VD+ AA LG+PVV P + +VAEHA+ ++ + + R R+ Sbjct: 65 KVIGRPGVGVDDVDVEAATELGIPVVIAPGANTRSVAEHAMAMMFACAKDMVRCDKEMRK 124 Query: 130 GDFSLHG-LTGFDLHGKRVGVIGTGQIGETFARIMAGFGCELLAYDPYPNPRI-QALGGR 187 G+F++ ++L+GK +G+IG G IG A + G G ++L YDP+ + +A G Sbjct: 125 GNFAIRSEYKAYELNGKVLGLIGCGHIGNILAEMATGIGMKVLVYDPFVKAEVVEAKGYG 184 Query: 188 YLA-LDALLAESDIVSLHCPLTADTRHLIDAQRLATMKPGAMLINTGRGALVNAAALIEA 246 Y A ++ +L E+D+VS+H PLT T+++I + L MK +LIN RG ++N AL +A Sbjct: 185 YRAEMEDILKEADVVSIHTPLTPKTKNMIGEKELKLMKSTGILINCARGGIINEEALCKA 244 Query: 247 LKSGQLGYLGLDVYEEEADIFFEDRSDQPLQDDVLARLLSFPNVVVTAHQAFLTREALAA 306 L + DV E P+ D L N++VT H A T+EA + Sbjct: 245 LSENWIHSAATDVVVHE-----------PISVD--DPLFMHENIIVTPHMAGQTKEAASG 291 Query: 307 IADTTLDNIAAWQDGTPRNRV 327 +A + + A +G ++V Sbjct: 292 VATMAAEGVMAVINGQKWDKV 312 Lambda K H 0.323 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 242 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 326 Length adjustment: 28 Effective length of query: 301 Effective length of database: 298 Effective search space: 89698 Effective search space used: 89698 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory