Align Putative phosphotransferase enzyme IIA component YpqE (characterized, see rationale)
to candidate WP_008537264.1 HMPREF9454_RS00490 PTS glucose transporter subunit IIA
Query= uniprot:P50829 (168 letters) >NCBI__GCF_000245775.1:WP_008537264.1 Length = 160 Score = 122 bits (305), Expect = 4e-33 Identities = 63/143 (44%), Positives = 89/143 (62%), Gaps = 6/143 (4%) Query: 17 EEVIYSPADGTVMDLSDVPDPVFSQKMMGEGIAVEPSSGEIVSPAEGEVIQIFHTKHAVG 76 E+ SP G V+ +SD+PDP F+QKMMG+G +E + G +V+P + +V F T HA G Sbjct: 12 EKNFVSPMTGKVVAMSDIPDPAFAQKMMGDGCGIELTDGTVVAPFDAKVTAAFPTGHAFG 71 Query: 77 IRTRS-GIELLIHVGLETVNMNGEGFTAHIKEGDKVKVGDPLITCDLELIKEKASSTVIP 135 + + G E+LIH+G++TV M GEGF+++IK GD+VK GD L+ DLE+++E S V P Sbjct: 72 LEAKEDGTEVLIHIGIDTVEMEGEGFSSNIKVGDEVKQGDVLVVVDLEVVQEAGKSLVSP 131 Query: 136 IVIMNGEAV-----GSMVSAGEK 153 I V V AGEK Sbjct: 132 IAFTGNNKVEVFKIEQNVVAGEK 154 Lambda K H 0.314 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 118 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 168 Length of database: 160 Length adjustment: 18 Effective length of query: 150 Effective length of database: 142 Effective search space: 21300 Effective search space used: 21300 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory