Align Alpha-glucosidase; EC 3.2.1.- (characterized, see rationale)
to candidate WP_008539445.1 HMPREF9454_RS09460 alpha-glucosidase
Query= uniprot:A8LLL3 (552 letters) >NCBI__GCF_000245775.1:WP_008539445.1 Length = 556 Score = 320 bits (821), Expect = 7e-92 Identities = 188/524 (35%), Positives = 280/524 (53%), Gaps = 53/524 (10%) Query: 19 WWRGAVIYQIYPRSFQDSNGDGIGDLLGIVERMPYIASLGVDAIWISPFFTSPMKDFGYD 78 WW+ V+YQIYP+SF DSNGDGIGD+ GI+ ++ Y+ LGV AIW+ P + SP+ D GYD Sbjct: 6 WWQKTVVYQIYPKSFCDSNGDGIGDIPGIISKLDYLQDLGVGAIWLCPIYPSPLVDNGYD 65 Query: 79 ISDYFDVDPMFGSLADFDALIETAHMYGLRVMIDLVLSHTSDQHPWFEESRSSRDNPKAD 138 ISDY V +G++ D + LI A +++++DLV +HTSD+H WFEESRSS+DNPK D Sbjct: 66 ISDYCSVAKEYGTMEDMERLISEADKRNIKIVMDLVFNHTSDKHKWFEESRSSKDNPKRD 125 Query: 139 WYVWADAKPDGTPPNNWLSIFGGSGWHWDARRCQYYLHNFLTSQPDLNFHCADVQDALLG 198 WY+W D K DG+ P NW SIFGGS W D + QYYLH F ++QPDLN+ +V+ AL Sbjct: 126 WYIWRDGKEDGSAPTNWRSIFGGSAWTLDEKTNQYYLHTFASAQPDLNWENKEVRQALFD 185 Query: 199 VGRFWLDRGVDGFRLDTINFYVHDAELRDNPPLPPEERNSNIAPEVNPYNHQRHLYSKNQ 258 FWLD+GV GFR+D I + +E +D P + N+A +Q + Sbjct: 186 AANFWLDKGVRGFRIDAIVYIKKPSEFKD----LPVDGADNLASIAKATTYQDGI----- 236 Query: 259 PENLEFLAKFRAMMEEYPAIAAVGEVGDAQYGLEILGQYTRGETGV-HMCYAFEFLA--- 314 L+FL +FR + + I V E D Y + GE G M + F + Sbjct: 237 ---LDFLHEFREKVFDRADIFTVAE-ADGVYPSDF--DKWIGENGAFDMSFDFSHIRLGF 290 Query: 315 QEKLTAKR--------VAEVLNKVDEVASD-GWACWAFSNHDVMRHVS----RWDLTPGA 361 E T + + + + +E D GW F NHD+ R + + T A Sbjct: 291 DEDCTWHKRKSWKLIDIRKCFTEDEEATKDNGWVPVYFENHDLPRCTNYFFPQGTDTKLA 350 Query: 362 QRGMLTLLMCLRGSVCLYQGEELG-----------------LPEAEVAFDDLQDPYGIEF 404 + + T+L+ +RG+ +Y+G+ELG + + E+A D P Sbjct: 351 AKFIATILLTMRGTPFIYEGQELGVTNIKWPSIKMYNDISSIGQYELALKDKLTPKEAMK 410 Query: 405 WPEYKGRDGCRTPMVWQSDNMSGGFSIHRPWLPVSTEHLGLAVAVQEEAPDALLHHYRRA 464 RD R+PM W S + GF+ RPWLP++ E+ L V + E +++L++Y+ Sbjct: 411 GVWKYSRDNARSPMTWNSGS-KAGFTTGRPWLPLNDEYPKLNVETETEDENSVLNYYKNL 469 Query: 465 LAFRRAHPALVKGDISD-VTVVGDVISFLR--KDPEETVFVAIN 505 + R+ +PAL++GD + ++ + ++ R KD E + V N Sbjct: 470 IKLRKQYPALIEGDYEELLSYSPGIYAYARTTKDKSERIIVIAN 513 Lambda K H 0.321 0.138 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 880 Number of extensions: 38 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 552 Length of database: 556 Length adjustment: 36 Effective length of query: 516 Effective length of database: 520 Effective search space: 268320 Effective search space used: 268320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory