Align PTS system mannose-specific EIID component; EII-M-Man; EIID-Man; Mannose permease IID component (characterized)
to candidate WP_010630730.1 RH97_RS02395 PTS mannose/fructose/sorbose transporter family subunit IID
Query= SwissProt::P69805 (283 letters) >NCBI__GCF_000246965.1:WP_010630730.1 Length = 303 Score = 296 bits (757), Expect = 5e-85 Identities = 144/291 (49%), Positives = 200/291 (68%), Gaps = 30/291 (10%) Query: 12 KLTQSDIRGVFLRSNLFQGSWNFERMQALGFCFSMVPAIRRLYPENNEARKQAIRRHLEF 71 KLT+ D V+ RS QGSWN+ERMQ G+ ++M+PAI++LY + E R +A++RHLEF Sbjct: 6 KLTKKDRISVWWRSTFLQGSWNYERMQNGGWAYTMIPAIKKLY-KTKEDRAEALKRHLEF 64 Query: 72 FNTQPFVAAPILGVTLALEEQRANGAEIDDGAINGIKVGLMGPLAGVGDPIFWGTVRPVF 131 FNT P+VA+PI+GVTLALEE+RANGA +DD AI G+KVG+MGPLAG+GDP+FW TV+P+ Sbjct: 65 FNTHPYVASPIIGVTLALEEERANGAPVDDVAIQGVKVGMMGPLAGIGDPVFWFTVKPIL 124 Query: 132 AALGAGIAMSGSLLGPLLFFILFNLVRLATRYYGVAYGYSKGIDIVKDMGGGFLQKLTEG 191 AL A +AM+G++LGP+L+F+ +N++R+A +Y +GY G I +D+ GG LQ +T+G Sbjct: 125 GALAASLAMTGNILGPILYFVGWNIIRMAFMWYTQEFGYKAGSKITEDLSGGLLQDITKG 184 Query: 192 ASILGLFVMGALVNKWTHVNIPLVVSRITDQTG--------------------------- 224 ASILG+F++GALVN+W + VVS + G Sbjct: 185 ASILGMFILGALVNRWVSIKFTPVVSSVKLDKGAYIDWSNLPAGAQGIKSALEQQAAGLS 244 Query: 225 --KEHVTTVQTILDQLMPGLVPLLLTFACMWLLRKKVNPLWIIVGFFVIGI 273 VTT+Q LD L+PGL L+LT CMWLL+KKV+P+ II+G FV+G+ Sbjct: 245 LEAHKVTTLQNNLDSLIPGLAALVLTLFCMWLLKKKVSPIVIILGLFVVGV 295 Lambda K H 0.326 0.143 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 289 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 283 Length of database: 303 Length adjustment: 26 Effective length of query: 257 Effective length of database: 277 Effective search space: 71189 Effective search space used: 71189 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory