Align fructokinase (EC 2.7.1.4) (characterized)
to candidate WP_010632787.1 RH97_RS12875 ROK family protein
Query= BRENDA::O05510 (299 letters) >NCBI__GCF_000246965.1:WP_010632787.1 Length = 286 Score = 304 bits (779), Expect = 1e-87 Identities = 147/288 (51%), Positives = 195/288 (67%), Gaps = 4/288 (1%) Query: 1 MLGGIEAGGTKFVCAVGREDGTIIDRIEFPTKMPDETIEKVIQYFSQFSLQAIGIGSFGP 60 M G IEAGGTKFVCAV +D I++R+E PT ET+ V +F++ + A+GIGSFGP Sbjct: 1 MYGAIEAGGTKFVCAVSDKDLNIVNRVEIPTTSTKETMTMVFDFFNKHPVSAMGIGSFGP 60 Query: 61 VDNDKTSQTYGTITATPKAGWRHYPFLQTVKNEMKIPVGFSTDVNAAALGEFLFGEAKGL 120 +D ++ S TYG IT TPK WR+Y FL +K IP ++TDVN AA GE G A G Sbjct: 61 IDVNRNSNTYGYITTTPKKSWRNYNFLGVMKEHFNIPYVWTTDVNVAAYGELKRGIALGK 120 Query: 121 DSCLYITIGTGIGAGAIVEGRLLQGLSHPEMGHIYIRRHPDDVYQGKCPYHGDCFEGLAS 180 +SC+Y+T+GTGIG G ++ G+L++ HPEMGH+ IRRH DD ++G CPYHGDC EG+A+ Sbjct: 121 NSCIYLTVGTGIGGGGVINGQLMENFGHPEMGHLLIRRHSDDQFKGLCPYHGDCLEGMAA 180 Query: 181 GPAIEARWGKKAADLSDIAQVWELEGYYIAQALAQYILILAPKKIILGGGVMQQKQVFSY 240 GPAIEAR+GKKA ++ ++WE+E YY+AQA L LAP+ II GGGVM+Q Q+ Sbjct: 181 GPAIEARYGKKAFEIPADDRIWEIEAYYLAQASVDLTLTLAPEMIIFGGGVMKQPQLLPL 240 Query: 241 IYQYVPKIMNSYLDFSELSDDISDYIVPPRLGSNAGIIGTLVLAHQAL 288 I MN+Y+ + DI +YIV +L NAGI G L+LA + L Sbjct: 241 IKSSFTSQMNNYVK----TPDIDEYIVHCKLRDNAGITGCLLLARELL 284 Lambda K H 0.320 0.139 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 255 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 286 Length adjustment: 26 Effective length of query: 273 Effective length of database: 260 Effective search space: 70980 Effective search space used: 70980 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory