Align Sorbitol dehydrogenase (EC 1.1.1.14) (characterized)
to candidate WP_010630985.1 RH97_RS03700 3-oxoacyl-[acyl-carrier-protein] reductase
Query= reanno::Phaeo:GFF1301 (257 letters) >NCBI__GCF_000246965.1:WP_010630985.1 Length = 248 Score = 155 bits (392), Expect = 8e-43 Identities = 95/257 (36%), Positives = 140/257 (54%), Gaps = 16/257 (6%) Query: 4 LSGKRALITGAARGIGAAFAEAYANEGARVVIADI-DTARAEATAAQI---GAAAIAVEL 59 L GK AL+TGA+RGIG A A A+A EGA VV+ + ARAE TAA+I G A+ + Sbjct: 3 LKGKAALVTGASRGIGKAIALAFAREGASVVVNYAGNKARAEETAAEIRELGQEALVYQC 62 Query: 60 DVTDQASIDRALSRTVECFGGLDILINNAAVFTAAPLVEVTREAYQRTFDINVSGTLFMM 119 DVT + + + + FG LDI++NNA + L+ + + + N+ G + Sbjct: 63 DVTSEPDVQEMIKTVSKKFGHLDIVVNNAGITRDGLLMRIKEADWDAVLNTNLKGVFLVT 122 Query: 120 QAAAQQMITQGTGGKIINMASQAGRRGEPLVSVYCATKAAVISLTQSAGLNLISHGINVN 179 +AA + M+ Q +G KIIN+AS G G + Y A KA VI LT++ + S GI VN Sbjct: 123 KAALRPMMRQRSG-KIINIASVVGILGNAGQANYSAAKAGVIGLTKTTAREVASRGITVN 181 Query: 180 AIAPGVVDGEHWDGVDAFFAKYEGKAPGQKKAEVAQSVPYGRMGTAADLTGMAVFLASED 239 A+APG + + + P Q K ++ +P R+GT D+ + FLAS+D Sbjct: 182 AVAPGFI-----------ITEMTAELPDQVKEQMKAQIPLQRLGTPEDVASVVRFLASDD 230 Query: 240 ADYVVAQTYNVDGGQWM 256 ++Y+ Q +VDGG M Sbjct: 231 SNYMTGQILSVDGGMAM 247 Lambda K H 0.317 0.130 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 110 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 248 Length adjustment: 24 Effective length of query: 233 Effective length of database: 224 Effective search space: 52192 Effective search space used: 52192 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory