Align L-iditol 2-dehydrogenase (EC 1.1.1.14) (characterized)
to candidate WP_010631734.1 RH97_RS07450 zinc-dependent alcohol dehydrogenase family protein
Query= BRENDA::Q5I6M3 (368 letters) >NCBI__GCF_000246965.1:WP_010631734.1 Length = 332 Score = 152 bits (383), Expect = 2e-41 Identities = 95/298 (31%), Positives = 147/298 (49%), Gaps = 19/298 (6%) Query: 45 PNDVRIRIKAVGICGSDVHYLKTMKCADFEVKEPMVIGHECAGIVDKVGSEV-KHLVPGD 103 P +VR+R+ VGICG+D H L + E + P+++GHE +GIVD +GSE+ L GD Sbjct: 24 PGEVRVRVSYVGICGTDKH-LYGGQPGSGEARIPVILGHEISGIVDSLGSEIHSDLKIGD 82 Query: 104 RVAVEPGISCARCQQCKGGRYNLCPDMKFFATPPVHGSLANQIVHPADLCFKLPENVSLE 163 RVA++P I C C+ C+ GR LC + + +G +A + P +K+P+ +SL+ Sbjct: 83 RVAIDPNIPCGVCRFCREGRPQLCENNQAVGVTR-NGGMAEYVHVPETNVYKIPDGLSLK 141 Query: 164 EGAMCEPLSVGVHACRRANVGPETTVLIIGAGPIGLVSVLAARAFGAPRIVIVDMDDKRL 223 AM EP+S VH ++ P T L+IG G IG + L G ++ + + K++ Sbjct: 142 AAAMAEPVSCVVHGLDELDIKPHDTALVIGDGFIGQIFTLLLAQQGLKKVAVSGHNPKKI 201 Query: 224 AMAKSLGADEAVKVSTKMEDLDDEVAEIKEAMISEVDVTFDCVGFNKTMSTGLNATRPGG 283 A+ K +GADE KE D+ +CVG T L GG Sbjct: 202 ALLKKIGADEVFNPE-------------KEEHSERYDLVIECVGLPNTQEQALTFAARGG 248 Query: 284 KVCLVGMGH--GVMTVPLTPAAAREVDVVGVFRYQNTWPLCLEFLRSGKIDVKPLITH 339 +V + G+ + T+ P E+ V G F + + + +G DV+ LITH Sbjct: 249 QVLMFGVSNPDDTFTIKSYPIFFNELTVKGAFINPHAMQDAIHLMVAG-ADVESLITH 305 Lambda K H 0.321 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 338 Number of extensions: 26 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 368 Length of database: 332 Length adjustment: 29 Effective length of query: 339 Effective length of database: 303 Effective search space: 102717 Effective search space used: 102717 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory