Align PTS system glucitol/sorbitol-specific EIIC component; EIIC-Gut; Glucitol/sorbitol permease IIC component (characterized)
to candidate WP_010631560.1 RH97_RS06585 PTS sorbitol transporter subunit IIC
Query= SwissProt::O32332 (182 letters) >NCBI__GCF_000246965.1:WP_010631560.1 Length = 183 Score = 246 bits (627), Expect = 2e-70 Identities = 114/180 (63%), Positives = 146/180 (81%) Query: 1 MDAIVYFAKGFMYLFEVGGNTFVSWVTGIIPKVLLLLVFMNSIIAFIGQDKVDRFAKFAS 60 MD +V+ AKGF+ LF+ G TF+SW++GI+P VL+LLV MNS+I IGQD++++ A +S Sbjct: 1 MDILVFLAKGFIGLFQYGAKTFISWMSGIVPVVLMLLVAMNSLIRLIGQDRINKLAAKSS 60 Query: 61 RNVILAYGVLPFLSAFMLGNPMALSMGKFLPERMKPSYYASASYHCHTNSGIFPHINVGE 120 +N +L Y VLPFL AFML NPMALS+G+FLPER KPSYYASA+Y CHT++GIFPHIN GE Sbjct: 61 KNPLLRYMVLPFLGAFMLANPMALSLGRFLPERYKPSYYASAAYFCHTSNGIFPHINAGE 120 Query: 121 IFIYLGIANGITTLGLDPTALGLRYLLVGLVMNFFAGWVTDFTTKIVMRQQGIELSNQLK 180 +FI+LGIA G+ LGLD T L LRYLLVGLV NFF GW+TDFTT V +QQ ++LS +++ Sbjct: 121 LFIWLGIAQGVQKLGLDTTPLALRYLLVGLVANFFCGWITDFTTPWVEKQQNVKLSKEIE 180 Lambda K H 0.329 0.144 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 182 Length of database: 183 Length adjustment: 19 Effective length of query: 163 Effective length of database: 164 Effective search space: 26732 Effective search space used: 26732 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory