Align Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140) (characterized)
to candidate WP_010631563.1 RH97_RS06600 SDR family oxidoreductase
Query= reanno::Koxy:BWI76_RS01745 (267 letters) >NCBI__GCF_000246965.1:WP_010631563.1 Length = 267 Score = 299 bits (765), Expect = 5e-86 Identities = 154/265 (58%), Positives = 191/265 (72%), Gaps = 1/265 (0%) Query: 3 TWLNLKEKIITVTGGASGIGLAIVDELLAQGANVQMIDIHGGDKHQSSGNYNFWPTDISS 62 +WL L++K+I VTGGASGIG IV L A GA V + DIH QS + D++S Sbjct: 4 SWLGLEKKVIVVTGGASGIGKHIVATLAAAGAQVVVCDIHVKTGDQSENGVYYVQMDVTS 63 Query: 63 ASEVHKTVDHIIQRFGRIDGLVNNAGVNFPRLLVDEKAPSGRYELNEAAFEKMVNINQKG 122 V V H+ +FG IDGLVN+AG+N PRLLVD + +YEL+E F M+ +N KG Sbjct: 64 KESVENMVSHVAAKFGGIDGLVNDAGINLPRLLVDFRGEKPQYELSEKDFNLMIGVNVKG 123 Query: 123 VFLMSQAVARQMVKQRSGVIVNVSSESGLEGSEGQSCYAATKAALNSFTRSWSKELGKHG 182 VFL SQAV RQ +K+ SGVIVN+SSE+G+EGS GQS Y+ATK A+N FTRSW+KELG H Sbjct: 124 VFLTSQAVVRQFLKKGSGVIVNISSEAGMEGSNGQSVYSATKGAVNGFTRSWAKELGSHH 183 Query: 183 IRVVGVAPGILEKTGLRTPEYEEALAWTRNITVEQLREGYSKNSIPLGRSGRLTEVADFV 242 IRVVGVAPGI EKTGL T Y EALA+TRNI+V +L YSK +IPLGR G+L ++ + V Sbjct: 184 IRVVGVAPGINEKTGLTTDTYNEALAYTRNISVSELGTDYSK-AIPLGRPGKLDDIGNLV 242 Query: 243 CYLLSERASYMTGVTTNIAGGKTRG 267 YLLS+RA+Y+TG T NI GGK+RG Sbjct: 243 TYLLSDRAAYITGTTVNITGGKSRG 267 Lambda K H 0.315 0.132 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 220 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 267 Length adjustment: 25 Effective length of query: 242 Effective length of database: 242 Effective search space: 58564 Effective search space used: 58564 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory