Align D-xylose 1-dehydrogenase (EC 1.1.1.175) (characterized)
to candidate WP_010632153.1 RH97_RS09595 SDR family oxidoreductase
Query= reanno::Korea:Ga0059261_1894 (259 letters) >NCBI__GCF_000246965.1:WP_010632153.1 Length = 314 Score = 124 bits (310), Expect = 3e-33 Identities = 80/244 (32%), Positives = 129/244 (52%), Gaps = 4/244 (1%) Query: 16 LKGKRVLVTGGGSGIGAGIVEGFARQGADVTFFDIAGAESQLLVE-RLSADGHKACFERV 74 L GK L+TGG SGIGA + FA++GADV + E + R+ G ++ Sbjct: 68 LTGKVALITGGDSGIGAAVAIAFAKEGADVAISYLDEHEDANRTKARIEQLGQRSILLPG 127 Query: 75 DLTDVASLQAVIARLIKGAGGFDILVNNAAND-DRHAIDEITEAYWDERLSVNLKHIFFC 133 D+ D +++ + I+ G DILVN+ + ++ +IT+ +D+ VN+ F+ Sbjct: 128 DVRDKIQCISIVEQTIQSFGRLDILVNHVGIQFQQPSLLDITDEQFDDTFKVNIYSHFYT 187 Query: 134 AQAVVPAMRARGGGAIVNLGSISWHLGLSDLVLYQTCKAAIEGLTRSLARDLGRDGIRAT 193 + +P ++ G +I+N S++ G S L+ Y + KAAI G TR+LA +L GIR Sbjct: 188 TRTALPYLKP--GSSIINTSSVTAFKGPSQLIDYTSTKAAIIGFTRALANNLIDKGIRVN 245 Query: 194 CVIPGNVRTPRQLKWYSPEGEAEIVAAQCLDGRLAPEDVAAMVLFLASDDARLVTGHSYF 253 V PG+ TP Q YS + A + + + P ++A ++LASDD+R VTG + Sbjct: 246 AVAPGSTWTPLQPSTYSADQVAILGSGNPMRRMAQPFELAPAYVYLASDDSRFVTGQTIH 305 Query: 254 VDAG 257 V+ G Sbjct: 306 VNGG 309 Lambda K H 0.321 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 174 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 314 Length adjustment: 26 Effective length of query: 233 Effective length of database: 288 Effective search space: 67104 Effective search space used: 67104 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory