Align Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 (characterized)
to candidate WP_010181310.1 KQA_RS0211605 phosphate acetyltransferase
Query= SwissProt::P77844 (329 letters) >NCBI__GCF_000255455.1:WP_010181310.1 Length = 697 Score = 357 bits (916), Expect = e-103 Identities = 178/327 (54%), Positives = 236/327 (72%), Gaps = 2/327 (0%) Query: 1 MSAELFENWLLKRARAEHSHIVLPEGDDDRILMAAHQLLDQDICDITILGDPVKIKERAT 60 ++ +F+ LLKRA+ + IVLPEG D+RI+ A +LL + D+ +LG+ VKIK +A Sbjct: 368 VTPRMFQYNLLKRAQTQRKRIVLPEGYDERIIRATSRLLASGVVDVILLGNEVKIKNKAV 427 Query: 61 ELGL--HLNTAYLVNPLTDPRLEEFAEQFAELRKSKSVTIDEAREIMKDISYFGTMMVHN 118 +LG+ L +++P+ P +++ + ELRK K+V +D AR++M D+SYFGTMM++ Sbjct: 428 KLGVPFDLKRMTIIDPVNSPHFDDYVQTLYELRKHKNVNMDMARDLMADVSYFGTMMIYK 487 Query: 119 GDADGMVSGAANTTAHTIKPSFQIIKTVPEASVVSSIFLMVLRGRLWAFGDCAVNPNPTA 178 G ADGMVSGA NTT HTI+P+ Q IKT P ASVVSS+F M L GR+ FGDCA+NPNP A Sbjct: 488 GHADGMVSGAVNTTQHTIRPALQFIKTKPTASVVSSVFFMCLEGRVSIFGDCAINPNPNA 547 Query: 179 EQLGEIAVVSAKTAAQFGIDPRVAILSYSTGNSGGGSDVDRAIDALAEARRLNPELCVDG 238 QL EIA+ SA TA FGI+ ++A+LSYS+G+SG G DVD+ +A + +L ++G Sbjct: 548 AQLAEIAIASADTAVNFGIEAKIAMLSYSSGDSGKGVDVDKVREATKIVKEKRTDLKIEG 607 Query: 239 PLQFDAAVDPGVARKKMPDSDVAGQANVFIFPDLEAGNIGYKTAQRTGHALAVGPILQGL 298 P+Q+DAAVD V + K+P+S+VAGQA+V IFPDL GN YK QR ALA+GP+LQGL Sbjct: 608 PIQYDAAVDYAVGKSKLPNSEVAGQASVLIFPDLNTGNNTYKAVQRETGALAIGPMLQGL 667 Query: 299 NKPVNDLSRGATVPDIVNTVAITAIQA 325 NKPVNDLSRG TV DI NTV ITAIQA Sbjct: 668 NKPVNDLSRGCTVADIYNTVIITAIQA 694 Lambda K H 0.318 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 494 Number of extensions: 24 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 697 Length adjustment: 33 Effective length of query: 296 Effective length of database: 664 Effective search space: 196544 Effective search space used: 196544 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate WP_010181310.1 KQA_RS0211605 (phosphate acetyltransferase)
to HMM TIGR00651 (pta: phosphate acetyltransferase (EC 2.3.1.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00651.hmm # target sequence database: /tmp/gapView.2562451.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00651 [M=304] Accession: TIGR00651 Description: pta: phosphate acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-127 411.1 0.6 2.6e-127 410.5 0.6 1.3 1 NCBI__GCF_000255455.1:WP_010181310.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000255455.1:WP_010181310.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 410.5 0.6 2.6e-127 2.6e-127 1 304 [] 388 691 .. 388 691 .. 0.99 Alignments for each domain: == domain 1 score: 410.5 bits; conditional E-value: 2.6e-127 TIGR00651 1 ivlPEgseervlkAaallaekkiaekvllvnkeeevkn.kakevnlklgkvvvedpdvskdiekyverlyekr 72 ivlPEg +er+++A + l+ +++++ +ll+n+ +++++ +v +l++++++dp s++ ++yv++lye+r NCBI__GCF_000255455.1:WP_010181310.1 388 IVLPEGYDERIIRATSRLLASGVVDVILLGNEVKIKNKaVKLGVPFDLKRMTIIDPVNSPHFDDYVQTLYELR 460 8*****************************9999988745678999*************************** PP TIGR00651 73 khkGvtekeareqlrDevslaallvelgeadglvsGavsttaktlrpalqiiktlegvklvssvfimekeeev 145 khk v++ +ar+ + D ++++++++++g+adg+vsGav+tt++t+rpalq ikt+++ ++vssvf+m++e +v NCBI__GCF_000255455.1:WP_010181310.1 461 KHKNVNMDMARDLMADVSYFGTMMIYKGHADGMVSGAVNTTQHTIRPALQFIKTKPTASVVSSVFFMCLEGRV 533 ************************************************************************* PP TIGR00651 146 lvfaDCavavdPnaeeLAeiAlqsaksakslgeeepkvallsystkgsgkgeevekvkeAvkilkekepdlll 218 +f+DCa++++Pna +LAeiA+ sa++a ++g +e k+a+lsys++ sgkg +v+kv+eA+ki+kek++dl++ NCBI__GCF_000255455.1:WP_010181310.1 534 SIFGDCAINPNPNAAQLAEIAIASADTAVNFG-IEAKIAMLSYSSGDSGKGVDVDKVREATKIVKEKRTDLKI 605 ********************************.**************************************** PP TIGR00651 219 dGelqfDaAlvekvaekkapesevagkanvfvFPdLdaGnigYkivqRladaeaiGPilqGlakPvnDLsRGa 291 +G++q+DaA+ v ++k p+sevag+a v++FPdL++Gn++Yk+vqR+++a aiGP+lqGl+kPvnDLsRG+ NCBI__GCF_000255455.1:WP_010181310.1 606 EGPIQYDAAVDYAVGKSKLPNSEVAGQASVLIFPDLNTGNNTYKAVQRETGALAIGPMLQGLNKPVNDLSRGC 678 ************************************************************************* PP TIGR00651 292 svedivnvviita 304 +v di+n+viita NCBI__GCF_000255455.1:WP_010181310.1 679 TVADIYNTVIITA 691 ***********97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (697 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 16.40 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory