Align Anthranilate 1,2-dioxygenase system ferredoxin--NAD(+) reductase component; EC 1.18.1.3 (characterized)
to candidate WP_010177730.1 KQA_RS0202470 NAD(P)/FAD-dependent oxidoreductase
Query= SwissProt::Q84BZ0 (406 letters) >NCBI__GCF_000255455.1:WP_010177730.1 Length = 417 Score = 206 bits (525), Expect = 8e-58 Identities = 134/397 (33%), Positives = 205/397 (51%), Gaps = 8/397 (2%) Query: 7 VIVGAGHAARRTAEALRARDADAPIVMIGAERELPYDRPALSKDALLNDDGEQRAFVRDA 66 V++GA HA A +LR + I++ + LPY RP LSK L + D + ++ A Sbjct: 12 VVIGASHAGVNFAFSLRKEGWEGRIILFDKDPVLPYHRPPLSKAYLTSADAIDKNLLKSA 71 Query: 67 AWYDAQRIALRLGTRVDAIEREAQRVRLDDGTTLPYAKLVLATGSR--VRTFGGPIDAGV 124 YD I L LG ++ I+R A+ V L DG Y LVLATG+R + G +A Sbjct: 72 EAYDKSGIELSLGVTINTIDRVAKHVVLSDGRLQTYDTLVLATGARPIIPPIKGLREASN 131 Query: 125 VAHYVRTVADARALRAQLVRG--RRVAVLGGGFIGLEVAAAARQLGCNVTVIDPAARLLQ 182 V +RT D +R + ++V ++GGG+IGLE AA+ ++LG +VTV++ R+L Sbjct: 132 V-FTLRTANDVERIRKAMSTSVHKKVVIIGGGYIGLETAASLKKLGASVTVLEREERILA 190 Query: 183 RALPEVVGAYAHRLHDERGVGFQMATLPRAIRAAAGGGAIVETDRGDVHADVVVVGIGVL 242 R + + +LH GV +I A ++ D AD+++VG+GV Sbjct: 191 RVTAPEMSDFFEKLHASNGVEVLTNKNVVSIAKQANFNQVMCADTTSYEADIIIVGVGVH 250 Query: 243 PNVELAQAAGLDVDNGIRVDAGCRTADRAIFAAGEVTMHFNPLLGRHVRIESWQVAENQP 302 NV LA+ GLD+ NGI+V+ + A I+A G+ T H+NP R +R+ES Q A +Q Sbjct: 251 VNVALAEQVGLDIANGIKVNEAAKAA-TDIYAIGDCTSHYNPHYDRFIRLESVQNAVDQA 309 Query: 303 AVAAANLLGADDAYAELPWLWSDQYDCNLQMLGL-FGAGQTTVVRGDPARGPFTVFGLGG 361 +AAA + Y +PW WSDQYD LQM+GL G + + + + + F+++ Sbjct: 310 KIAAAAICDKKPVYNSIPWFWSDQYDIKLQMVGLSTGYTKALLRKEEGTQIKFSIWYFKN 369 Query: 362 DGRIVAAAAVNLGRDIGAARRLIAAGAMPDPQQLADP 398 D ++A AVN + + I D +L DP Sbjct: 370 D-ELLAVDAVNNAKAYVLGTKFIKNKTKIDQLKLVDP 405 Lambda K H 0.322 0.138 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 301 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 417 Length adjustment: 31 Effective length of query: 375 Effective length of database: 386 Effective search space: 144750 Effective search space used: 144750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory