Align Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale)
to candidate WP_010181874.1 KQA_RS0213190 peptidase domain-containing ABC transporter
Query= uniprot:P40735 (281 letters) >NCBI__GCF_000255455.1:WP_010181874.1 Length = 598 Score = 109 bits (273), Expect = 1e-28 Identities = 72/221 (32%), Positives = 123/221 (55%), Gaps = 21/221 (9%) Query: 7 ISVEDIVFRYRKDAERRALDGVSLQVYEGEWLAIVGHNGSGKSTLARALNGLILPESGDI 66 I + D+ FRY+ + E+ L+ ++L++ G + I+G NGSGKSTL + L L SG+I Sbjct: 358 IFINDMFFRYKSNEEQFILENINLEIPYGYHVGIIGRNGSGKSTLIKILTRLYNNYSGEI 417 Query: 67 EVAGIQLTEESVWEVRKKIGMVFQNPDNQFVGTTVRDDVAFGLENNGVPREEMIERVDWA 126 ++ I + S+ + RKK+ ++ Q D T+R+++ +G N EE++E A Sbjct: 418 KINNISIKNISMSDYRKKVAVIPQ--DIFLFDGTIRENILYG--NPSATTEEIVE----A 469 Query: 127 VKQVNMQDF-----------LDQEPHHLSGGQKQRVAIAGVIAARPDIIILDEATSMLDP 175 K + DF + Q LSGGQ+ ++A A + + P+IIILDEA+S LD Sbjct: 470 AKLAEIHDFIKNQYLGYNIKIGQNGIKLSGGQQLKIAFARLFISNPEIIILDEASSALDI 529 Query: 176 IGREEVLETVRHLKEQGMATVISITHDLNEAAKADRIIVMN 216 + +L+ ++ K +G T+ISI H ++ +D I++M+ Sbjct: 530 STEKIILKNIKD-KFKG-KTIISIAHRIHTLKSSDMIVIMD 568 Lambda K H 0.316 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 316 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 598 Length adjustment: 31 Effective length of query: 250 Effective length of database: 567 Effective search space: 141750 Effective search space used: 141750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory