Align 2-aminomuconate deaminase (EC 3.5.99.5) (characterized)
to candidate WP_010180305.1 KQA_RS0209075 RidA family protein
Query= metacyc::MONOMER-13362 (143 letters) >NCBI__GCF_000255455.1:WP_010180305.1 Length = 126 Score = 63.9 bits (154), Expect = 8e-16 Identities = 44/124 (35%), Positives = 64/124 (51%), Gaps = 11/124 (8%) Query: 14 PRGKFPHIKRAGDFLFVSGTSSRRPDNTLVGVEVDAMGTTRLDIVAQTTAVIENIRDILG 73 P G + D L++SG + P T + DA I +T V+EN++ IL Sbjct: 13 PIGPYNQAILTNDTLYISGQIAIDP--TTGNLITDA-------ITLETKQVLENLKAILT 63 Query: 74 SVGATLDDVVEISTFLVNMNDFAGYNEVYGTYFGYE-GPTRTTVAVHQLPHPHLLIEIKA 132 G T +++V+ S FL NM FA NE+Y YF + P R TVAV+ LP + +EI A Sbjct: 64 EAGFTFENIVKTSIFLTNMEYFATVNEIYADYFSNDAAPARETVAVNSLP-KGVNVEISA 122 Query: 133 VAYK 136 +A + Sbjct: 123 IAVR 126 Lambda K H 0.318 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 50 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 143 Length of database: 126 Length adjustment: 15 Effective length of query: 128 Effective length of database: 111 Effective search space: 14208 Effective search space used: 14208 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 42 (20.8 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory