Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate WP_010231305.1 ON07_RS11025 phosphoglycerate dehydrogenase
Query= BRENDA::O66939 (334 letters) >NCBI__GCF_000258765.1:WP_010231305.1 Length = 630 Score = 132 bits (332), Expect = 2e-35 Identities = 92/295 (31%), Positives = 158/295 (53%), Gaps = 23/295 (7%) Query: 16 YQEALKDL-----SLKIYTTDVSKVPENE-LKKAELISVFVYDKLTEELLSKMPRLKLIH 69 + +ALK L ++ IYT + + +E +K ++ + +LT+++L RL + Sbjct: 242 HPDALKILKNEGYNVSIYTGAMDEEELSERIKDVSVLGIRSKTQLTKKVLDNANRLIAVG 301 Query: 70 TRSVGFDHIDLDYCKKKGILVTHIPAYSPESVAEHTFAMILTLVKRLKRIEDRVKKLNFS 129 +G + IDL+ C KKG+ V + P + SV E I+ L++ L D++ K++ Sbjct: 302 AFCIGTNQIDLEECLKKGVAVFNAPFSNTRSVVELAIGEIILLMRNLP---DKISKMHDG 358 Query: 130 QDSEILAR--ELNRLTLGVIGTGRIGSRVAMYGLAFGMKVLCYDVVKREDLKEKGCVYTS 187 + + E+ LG++G G IGS++++ A G V YD+ ++ L +S Sbjct: 359 NWDKSASNSFEIRGKKLGIVGYGNIGSQLSILAEAIGFDVYYYDLTEKLALGN-ATKCSS 417 Query: 188 LDELLKESDVISLHVPYTKETHHMINEERISLMKDGVYLINTARGKVVDTDALYRAYQRG 247 ++ELLK+SD++SLHV KE ++I+E++ MKDGV +N +RG VV+ +AL + + G Sbjct: 418 MEELLKKSDIVSLHVDGRKENKNLISEKQFQQMKDGVIFLNLSRGHVVEIEALQQNIKSG 477 Query: 248 KFSGLGLDVFEDEEILILKKYTEGKATDKNLKILELACKDNVIITPHIAYYTDKS 302 K G G+DVF +E T + L+ L NVI+TPHI T+++ Sbjct: 478 KVRGAGVDVFPEE------PKTNNDTFESALRNL-----PNVILTPHIGGSTEEA 521 Lambda K H 0.319 0.138 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 531 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 630 Length adjustment: 33 Effective length of query: 301 Effective length of database: 597 Effective search space: 179697 Effective search space used: 179697 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory