Align alpha-ketoglutarate TRAP transporter, solute receptor component (characterized)
to candidate WP_040638997.1 MICLODRAFT_RS18595 TAXI family TRAP transporter solute-binding subunit
Query= reanno::psRCH2:GFF85 (317 letters) >NCBI__GCF_000262405.1:WP_040638997.1 Length = 314 Score = 373 bits (958), Expect = e-108 Identities = 187/308 (60%), Positives = 238/308 (77%), Gaps = 2/308 (0%) Query: 11 AAAAAFTASTAAVAAPTFINILTGGTSGVYYPIGVALSQQYN-KIDGAKTSVQATKASVE 69 AAA A ++ A FIN+LTGGTSGVYYP+GVALS+ ++ K+ G++ SVQATKASVE Sbjct: 8 AAALALAGASIPAQAQDFINVLTGGTSGVYYPLGVALSKVFSEKVQGSRPSVQATKASVE 67 Query: 70 NLNLLQAGRGELAFSLGDSVEDAWNGVEDAGFKAPLKRLRAIAGTYNNYIQIVASAESGI 129 NL LLQ G+GE+ F+LGDS+ W G E+AGFK+ L +LR + Y NYIQIVA+ ESGI Sbjct: 68 NLTLLQQGKGEIGFTLGDSLAMGWAGDEEAGFKSKLDKLRGVTAIYPNYIQIVATQESGI 127 Query: 130 KTLDDLKGKRISVGAPKSGTELNARAIFKAAGLDYKDMGRVEFLPYAESVELIKNRQLDA 189 K+L DLKGKR+SVGAPKSGTELNARAI AGL YKD+G+VE+LP+ ESVEL+KNRQLDA Sbjct: 128 KSLADLKGKRLSVGAPKSGTELNARAILHGAGLTYKDLGKVEYLPFGESVELMKNRQLDA 187 Query: 190 TLQSSGLGMAAIRDLASTMPVTFVEIPAEVVEKIESDAYLAGVIPAGTYDGQDADVPTVA 249 TLQS+GLG+++IRDL++++P+ VEIPA +VEK+ Y+ IPA TY GQ A V T A Sbjct: 188 TLQSAGLGVSSIRDLSTSVPIVVVEIPAAIVEKV-GTPYVKATIPANTYGGQTAPVETAA 246 Query: 250 ITNILVTHEKVSDEVAYQMTKLMFDNLAALGNAHSAAKDIKLENATKNLPIPLHPGAERF 309 + N LVTH V DE YQMTK ++++L L AH+AAKDIKLE+A +P+P+HPGA+R+ Sbjct: 247 VVNYLVTHSGVKDETVYQMTKAIYESLPDLSAAHAAAKDIKLESALSGMPVPMHPGAQRY 306 Query: 310 YKEAGVLK 317 + E GV K Sbjct: 307 FDEKGVKK 314 Lambda K H 0.314 0.131 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 332 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 314 Length adjustment: 27 Effective length of query: 290 Effective length of database: 287 Effective search space: 83230 Effective search space used: 83230 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory