Align glucokinase; EC 2.7.1.2 (characterized)
to candidate WP_009489786.1 MICLODRAFT_RS05260 ROK family transcriptional regulator
Query= CharProtDB::CH_014478 (324 letters) >NCBI__GCF_000262405.1:WP_009489786.1 Length = 386 Score = 141 bits (356), Expect = 2e-38 Identities = 84/262 (32%), Positives = 133/262 (50%), Gaps = 21/262 (8%) Query: 49 DIAKAIDKKLNDL-GEVKSR---LVGIGIGAPGPVNFANGSIEVAVNLGWEKFPIKDILE 104 D+++A+ + DL GE+ R + IG+ G V+ G + + NLGW P++ +L Sbjct: 114 DLSQAVSLGIQDLTGEIGRRPMDIRAIGVSISGLVD-TEGHLAQSPNLGWHDVPLRKLLR 172 Query: 105 VETSLPVVVDNDANIAAIGEMWKGAGDGAKDLLCVTLGTGVGGGVIANGEIVQGVNGAAG 164 P+ + N++N AAI E G G + L V G+GVGGG+I +G + +G G +G Sbjct: 173 KTVKHPLYIGNNSNSAAIAEQMFGHGTETDNFLYVESGSGVGGGLILDGSLYRGAAGFSG 232 Query: 165 EIGHITSIPEGGAPCNCGKTGCLETIASATGIVRLTMEELTETDKPSELRTVLEQNGQVT 224 EIGHI +P GG PC CG +GCL + I+R + + P+E+ E +VT Sbjct: 233 EIGHIKVVP-GGRPCRCGSSGCLSAYVADHAILRQLQHDGVDIHTPAEILARAEAGDKVT 291 Query: 225 SKDVFDAARSKDGLAMHVVDKVAFHLGLALANSANALNPEKIVLGGGVSRAGEVLLAPVR 284 + +++ HLGLALAN N LNP IVLGGG++R ++ +R Sbjct: 292 ---------------LATLEEAGNHLGLALANLVNLLNPPLIVLGGGLARFAPHIMPSLR 336 Query: 285 DYFKRFAFPRVAQGAELAIATL 306 + P + + ++T+ Sbjct: 337 QTLSAMSMPAPLRACSIEVSTV 358 Lambda K H 0.316 0.137 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 290 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 386 Length adjustment: 29 Effective length of query: 295 Effective length of database: 357 Effective search space: 105315 Effective search space used: 105315 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory