Align Citrate/succinate antiporter; Citrate carrier; Citrate transporter (characterized)
to candidate WP_016914153.1 HSS18214_RS0104730 DASS family sodium-coupled anion symporter
Query= SwissProt::P0AE74 (487 letters) >NCBI__GCF_000275725.1:WP_016914153.1 Length = 488 Score = 289 bits (739), Expect = 2e-82 Identities = 162/498 (32%), Positives = 266/498 (53%), Gaps = 28/498 (5%) Query: 1 MSLAKDNIWKL-LAPLVVMGVMFLIPVPDGMPPQAWHYFAVFVAMIVGMILEPIPATAIS 59 MS N W +A + + +IP+P+G+ P AW A+FV IV +I + +P AIS Sbjct: 1 MSTLPFNPWSAAIAVATTLLIWLVIPLPEGLTPNAWLMLAIFVGTIVAIIGKAMPIGAIS 60 Query: 60 FIAVTICVIGSNYLLFDAKELADPAFNAQKQALKWGLAGFSSTTVWLVFGAFIFALGYEV 119 +A++I + +A+ L+ +++ +WL+ A + + G Sbjct: 61 VVAISIVAASG------------VTGDTPSEAINVALSSYANPLIWLIAIAIMISRGLIK 108 Query: 120 SGLGRRIALFLVKFMGKRTLTLGYAIVIIDILLAPFTPSNTARTGGTVFPVIKNLPPLFK 179 +GLG RI + + GKRTL +GY + ++ +AP TPSNTAR GG + P+++++ F Sbjct: 109 TGLGARIGYYFISIFGKRTLGIGYGLAFSELTIAPVTPSNTARGGGIIHPIMRSIAHSFD 168 Query: 180 SFPNDPSARRIGGYLMWMMVISTSLSSSMFVTGAAPNVLGLEFVSKIAG--IQISWLQWF 237 S P D ++ +IG YL + S ++S+MF+T APN L ++ +S G IQ+SWL W Sbjct: 169 SHPEDNTSGKIGKYLALVNYHSNPITSAMFITATAPNPLTVQLISSATGAEIQLSWLTWA 228 Query: 238 LCFLPVGVILLIIAPWLSYVLYKPEITHSEEVATWAGDELKTMGALTRREWTLIGLVLLS 297 + L G++ ++ P++ Y+LY PEI + A D+L +G L+R E ++ + L+ Sbjct: 229 IAMLLPGLVAILAMPYILYLLYPPEIKETPNATQLARDKLAELGKLSRNEGIMLFVFLVL 288 Query: 298 LGLWV------FGSEV-INATAVGLLAVSLMLALHVVPWKDITRYNSAWNTLVNLATLVV 350 L LW G V +N T + +SL+L V+ W+D+ + +AW+TL+ L++ Sbjct: 289 LLLWADIPAIFLGDAVTLNTTTSAFIGLSLLLLTGVLTWEDVLKEKNAWDTLLWFGALIM 348 Query: 351 MANGLTRSGFIDWFAGTMSTHLE--GFSPNATVIVLVLVFYFAHYLFASLSAHTATMLPV 408 MA+ L +G I WF+ M + + G +LVL F + HY FAS +AH M+ Sbjct: 349 MASQLNETGLISWFSANMQSWITTMGIGWAGASALLVLTFLYTHYFFASTTAHITAMMAA 408 Query: 409 ILAVGKGIPGVPMEQLCILLVLSIGIMGCLTPYATGPGVIIYGCGYVKSKDYWRLGAIFG 468 L VG + PM + I+ S IM LT YATG +I+G GY+ ++W+ G I Sbjct: 409 FLTVGLSLGAPPMPFVLIMAATS-SIMMTLTHYATGTSPVIFGSGYLTLGEWWKAGFIMS 467 Query: 469 VIYISMLLLVG---WPIL 483 V+ + + ++VG W +L Sbjct: 468 VVNLLIWVVVGGLWWKLL 485 Lambda K H 0.328 0.142 0.453 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 818 Number of extensions: 50 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 487 Length of database: 488 Length adjustment: 34 Effective length of query: 453 Effective length of database: 454 Effective search space: 205662 Effective search space used: 205662 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory