Align isobutanoate/2-methylbutanoate--CoA ligase (EC 6.2.1.1) (characterized)
to candidate WP_017222270.1 A923_RS0113825 long-chain-fatty-acid--CoA ligase
Query= metacyc::MONOMER-20125 (556 letters) >NCBI__GCF_000276805.1:WP_017222270.1 Length = 556 Score = 137 bits (346), Expect = 8e-37 Identities = 117/361 (32%), Positives = 170/361 (47%), Gaps = 31/361 (8%) Query: 185 DPMILNYTSGTTSSPKGVVHCHRGIFIMTVDSLIDWGVPKQPV----YLWTLPMFH--AN 238 D L YT GTT KG + HR I + V + P+ + + LP++H AN Sbjct: 207 DIAYLQYTGGTTGIAKGAMLTHRNI-VANVLQVYGQFSPRTLLSKDHVVTPLPLYHIFAN 265 Query: 239 GWSYPWGMAAVGGTNICLRK-FDSEIIYDMIKRHGVTHMCGAPVVLN-MLSNAPGSEPLK 296 S + M +GG N+ + D + +K + T G + + ML N Sbjct: 266 SVSLMFIMM-IGGRNLLITNPRDMDGFIKELKGYPFTIFFGLNTLFSGMLKNEKFRALDF 324 Query: 297 TTVQIMTAGAPPPSAVLFRTESL--GFAVSHGYGLTETAGLVVSCAWKKEWNHLPATERA 354 + + AG + + G V GYGLTE + +V S ++ Sbjct: 325 SNARFTIAGGMSTQEDVAKEWQAVTGMPVVEGYGLTECSPVVCSGIHTQQ---------- 374 Query: 355 RLKSRQGVGTVM-QTKIDVVDPVTGAAVKRDGSTLGEVVLRGGSVMLGYLKDPEGTAKSM 413 + G+G + T++ VV+ A + +GE+ +RG VM GY K + TA+S+ Sbjct: 375 --EYTAGIGVPLPSTEMRVVNDDHQAL---GVNVVGELQVRGPQVMSGYWKQAQATAESI 429 Query: 414 TADGWFYTGDVGVMHPDGYLEIKDRSKDVIISGGENLSSVEVESILYSHPDILEAAVVAR 473 ADGWF TGD+ M DG I DR KD+I+ G N+ SVE+E +L HPDI EAAVV Sbjct: 430 DADGWFSTGDMARMDQDGCFFIVDRKKDMILVSGFNVYSVEIEEVLRLHPDIEEAAVVGL 489 Query: 474 PDEFWGETPCAFVSLKKGLTKKPTEKEIVEYCRSKLPRYMVPKTVVFKEELPKTSTGKVQ 533 P GE AF+ K T KE+ +CR L Y VP+ + F+++LPK+ GKV Sbjct: 490 PHPVTGEQVKAFIC---SSNKALTSKEVQTHCRRYLTAYKVPRDIEFRDDLPKSPVGKVL 546 Query: 534 K 534 K Sbjct: 547 K 547 Lambda K H 0.319 0.135 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 668 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 556 Length of database: 556 Length adjustment: 36 Effective length of query: 520 Effective length of database: 520 Effective search space: 270400 Effective search space used: 270400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory