Align ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized)
to candidate WP_017219776.1 A923_RS0101025 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::Smeli:SMc04256 (361 letters) >NCBI__GCF_000276805.1:WP_017219776.1 Length = 360 Score = 266 bits (679), Expect = 8e-76 Identities = 139/296 (46%), Positives = 200/296 (67%), Gaps = 11/296 (3%) Query: 22 LNLDIDHGEFLVLLGSSGCGKSTLLNCIAGLLDVSDGQIFIKDRNVTWEEPKDRGIGMVF 81 +++DI GEF+VL+G SGCGKS++L IAGL ++ G+I + +R + E+P R I MVF Sbjct: 21 VSVDIKQGEFIVLVGPSGCGKSSILRSIAGLESITGGEIHLNNRRIDNEKPASRDIAMVF 80 Query: 82 QSYALYPQMTVEKNLSFGLKVAKIPPAEIEKRVKRASEILQIQPLLKRKPSELSGGQRQR 141 Q+YALYP MTV +NL++GLK I IE ++++ ++ L+I L+RKP++LSGGQRQR Sbjct: 81 QNYALYPHMTVYENLAYGLKNRGIDRDTIESKIEKVAKTLKIADYLERKPAKLSGGQRQR 140 Query: 142 VAIGRALVRDVDVFLFDEPLSNLDAKLRSELRVEIKRLHQSLKNTMIYVTHDQIEALTLA 201 VA+GRA+VRD +FLFDEPLSNLDA LR+ +R+EIK+L + L T +YVTHDQ+EA+TLA Sbjct: 141 VAMGRAIVRDPQLFLFDEPLSNLDASLRAHMRLEIKKLQRELAVTSVYVTHDQVEAMTLA 200 Query: 202 DRIAVMKSGVIQQLADPMTIYNAPENLFVAGFIGSPSMNFFRGEVEPKDGRSFVRAGGIA 261 DRI V+ G I+Q+ P +Y+ P + FVA FIGSP+MNF + E+ G I Sbjct: 201 DRIIVLNQGEIEQIGTPAEVYHQPASTFVASFIGSPAMNFHQAEIAD---------GVIN 251 Query: 262 FD-VTAYPAHTRLQPGQKVVLGLRPEHVKVDEARDGEPTHQAVVDIEEPMGADNLL 316 F+ + + A Q + LG+RPEH ++ ++ G + V EP+G + L+ Sbjct: 252 FEHQSIFIAEYAHLSAQTIQLGIRPEHAVLEPSKSG-LSFSLTVQAVEPLGPNQLV 306 Lambda K H 0.320 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 369 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 360 Length adjustment: 29 Effective length of query: 332 Effective length of database: 331 Effective search space: 109892 Effective search space used: 109892 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory