Align AraV, component of Arabinose, fructose, xylose porter (characterized)
to candidate WP_017219776.1 A923_RS0101025 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::Q97UF2 (371 letters) >NCBI__GCF_000276805.1:WP_017219776.1 Length = 360 Score = 205 bits (521), Expect = 2e-57 Identities = 111/288 (38%), Positives = 175/288 (60%), Gaps = 10/288 (3%) Query: 4 IRVENLSKIFKKGKTEVKAVDNVSITIDSGMAFGVLGPSGHGKTTFLRLIAGLEEPTSGY 63 + ++NL K ++ G +AV VS+ I G ++GPSG GK++ LR IAGLE T G Sbjct: 2 LALKNLVKTYENGH---QAVKGVSVDIKQGEFIVLVGPSGCGKSSILRSIAGLESITGGE 58 Query: 64 IYFDNEAVSSPRRVMMSPEKRGIAMVFQNWALYPNMTVFDNIAFPLKLAKVPKDKIENKV 123 I+ +N + + + P R IAMVFQN+ALYP+MTV++N+A+ LK + +D IE+K+ Sbjct: 59 IHLNNRRIDNEK-----PASRDIAMVFQNYALYPHMTVYENLAYGLKNRGIDRDTIESKI 113 Query: 124 KEVSEELGLSGVLNRYPKELSGGQMQRTAIARALVKDPKVLLLDEPFSNLDAQIRESARA 183 ++V++ L ++ L R P +LSGGQ QR A+ RA+V+DP++ L DEP SNLDA +R R Sbjct: 114 EKVAKTLKIADYLERKPAKLSGGQRQRVAMGRAIVRDPQLFLFDEPLSNLDASLRAHMRL 173 Query: 184 LVRKIQRERKLTTLIVSHDPADIFAIANKAGVIVNGKFAQIGTPTEIYEYPATDLIARLT 243 ++K+QRE +T++ V+HD + +A++ V+ G+ QIGTP E+Y PA+ +A Sbjct: 174 EIKKLQRELAVTSVYVTHDQVEAMTLADRIIVLNQGEIEQIGTPAEVYHQPASTFVASFI 233 Query: 244 GE--INLIQAKIIENNAIIANLKVPLNNMELKGQSNIVIGLRPDDLTL 289 G +N QA+I + + + + I +G+RP+ L Sbjct: 234 GSPAMNFHQAEIADGVINFEHQSIFIAEYAHLSAQTIQLGIRPEHAVL 281 Lambda K H 0.317 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 274 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 360 Length adjustment: 30 Effective length of query: 341 Effective length of database: 330 Effective search space: 112530 Effective search space used: 112530 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory