Align PTS system fructose-specific EIIB component; EIIB-Fru; Fructose-specific phosphotransferase enzyme IIB component; EC 2.7.1.202 (characterized)
to candidate WP_017223098.1 A923_RS0118060 PTS fructose transporter subunit IIBC
Query= SwissProt::D4GYE1 (158 letters) >NCBI__GCF_000276805.1:WP_017223098.1 Length = 586 Score = 91.3 bits (225), Expect = 2e-23 Identities = 49/112 (43%), Positives = 70/112 (62%), Gaps = 1/112 (0%) Query: 3 LVAVTSCPTGIAHSQMAAENLLQAGERLGHDIDVEVQGAMGTQDELASDAIAEADAVIIT 62 +VA+T+CPTG+AH+ MAAE L Q G+RLGH I VE +G++G +++L+S IA AD VII Sbjct: 133 IVAITACPTGVAHTFMAAEALEQEGQRLGHTIKVETRGSVGAKNQLSSAEIAAADVVIIA 192 Query: 63 SDTSVSRDRFDGKLVLKGTVKDGVNNAEAVVQKAVELAEAGKTGSVTFGSGD 114 +D + RFDGK V K + + + + A A+ + G T SGD Sbjct: 193 ADIDIDLARFDGKKVYKTSTGLALKKTKQTMDNAFNDAQVYRHGK-TAASGD 243 Score = 61.2 bits (147), Expect = 3e-14 Identities = 34/100 (34%), Positives = 55/100 (55%) Query: 1 MKLVAVTSCPTGIAHSQMAAENLLQAGERLGHDIDVEVQGAMGTQDELASDAIAEADAVI 60 MK+ VT+CP+GIA S +AA L +A L D+E ++ L IA A+ ++ Sbjct: 1 MKIAIVTACPSGIASSLIAAGLLEKAVTELKWQADIECHSSVAPMTSLTEQQIAAAECIV 60 Query: 61 ITSDTSVSRDRFDGKLVLKGTVKDGVNNAEAVVQKAVELA 100 I ++ +V+ RF GK V + V A+A +++A+E A Sbjct: 61 IAANANVNDSRFIGKKVYRSAVDAVFTEAKAYLEQAIENA 100 Lambda K H 0.309 0.128 0.345 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 158 Length of database: 586 Length adjustment: 26 Effective length of query: 132 Effective length of database: 560 Effective search space: 73920 Effective search space used: 73920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory