Align ABC transporter for L-Fucose, ATPase component (characterized)
to candidate WP_017219776.1 A923_RS0101025 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::Smeli:SM_b21106 (365 letters) >NCBI__GCF_000276805.1:WP_017219776.1 Length = 360 Score = 297 bits (760), Expect = 3e-85 Identities = 170/367 (46%), Positives = 226/367 (61%), Gaps = 21/367 (5%) Query: 4 VTLKKLVKRY-GALEVVHGIDLEVKDREFIALVGPSGCGKSTTLRMIAGLEEVSGGAIEI 62 + LK LVK Y + V G+ +++K EFI LVGPSGCGKS+ LR IAGLE ++GG I + Sbjct: 2 LALKNLVKTYENGHQAVKGVSVDIKQGEFIVLVGPSGCGKSSILRSIAGLESITGGEIHL 61 Query: 63 GGRKVNDLPPRARNISMVFQSYALYPHMTVAENMGFSLKIAGRPAEEIKTRVAEAAAILD 122 R++++ P +R+I+MVFQ+YALYPHMTV EN+ + LK G + I++++ + A L Sbjct: 62 NNRRIDNEKPASRDIAMVFQNYALYPHMTVYENLAYGLKNRGIDRDTIESKIEKVAKTLK 121 Query: 123 LAHLLERRPSQLSGGQRQRVAMGRAIVRQPDVFLFDEPLSNLDAKLRTQVRTEIKKLHAR 182 +A LER+P++LSGGQRQRVAMGRAIVR P +FLFDEPLSNLDA LR +R EIKKL Sbjct: 122 IADYLERKPAKLSGGQRQRVAMGRAIVRDPQLFLFDEPLSNLDASLRAHMRLEIKKLQRE 181 Query: 183 MQATMIYVTHDQVEAMTLSDRIVIMRDGHIEQVGTPEDVFRRPATKFVAGFIGSPPMNME 242 + T +YVTHDQVEAMTL+DRI+++ G IEQ+GTP +V+ +PA+ FVA FIGSP MN Sbjct: 182 LAVTSVYVTHDQVEAMTLADRIIVLNQGEIEQIGTPAEVYHQPASTFVASFIGSPAMNFH 241 Query: 243 EAVLTDGKLAFASGATLPLPPRFRSLVREGQKVTFGLRPDD--VYPSGHGLHAGDADAVH 300 +A + DG + F + S Q + G+RP+ + PS GL Sbjct: 242 QAEIADGVINFEHQSIFIAEYAHLS----AQTIQLGIRPEHAVLEPSKSGL--------- 288 Query: 301 EIELPVTITEPLGNETLVFTQFNGRDWVSRMLNPR-PLRPGEAVPMSFDLARAHLFD--G 357 L V EPLG LV N D V L P + + + HLFD G Sbjct: 289 SFSLTVQAVEPLGPNQLVHGLVN--DKVFTALTPELHFASKQVLTLHVAKQHLHLFDKNG 346 Query: 358 ETGRALA 364 + +ALA Sbjct: 347 QRLQALA 353 Lambda K H 0.320 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 319 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 360 Length adjustment: 29 Effective length of query: 336 Effective length of database: 331 Effective search space: 111216 Effective search space used: 111216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory