Align ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized)
to candidate WP_017219776.1 A923_RS0101025 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::pseudo13_GW456_L13:PfGW456L13_1897 (386 letters) >NCBI__GCF_000276805.1:WP_017219776.1 Length = 360 Score = 295 bits (754), Expect = 2e-84 Identities = 172/372 (46%), Positives = 236/372 (63%), Gaps = 14/372 (3%) Query: 4 LELRNVNKTYGPGLPDTLKNIELKIDDGEFLILVGPSGCGKSTLMNCIAGLETISGGAIL 63 L L+N+ KTY G +K + + I GEF++LVGPSGCGKS+++ IAGLE+I+GG I Sbjct: 2 LALKNLVKTYENG-HQAVKGVSVDIKQGEFIVLVGPSGCGKSSILRSIAGLESITGGEIH 60 Query: 64 VDDADISGMSPKDRDIAMVFQSYALYPTMSVRDNIAFGLKIRKMPTAEIDEEVARVSKLL 123 +++ I P RDIAMVFQ+YALYP M+V +N+A+GLK R + I+ ++ +V+K L Sbjct: 61 LNNRRIDNEKPASRDIAMVFQNYALYPHMTVYENLAYGLKNRGIDRDTIESKIEKVAKTL 120 Query: 124 QIEHLLSRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKLMHQ 183 +I L RKP +LSGGQ+QRVAMGRA+ R P+++LFDEPLSNLDA LR MR E+K + + Sbjct: 121 KIADYLERKPAKLSGGQRQRVAMGRAIVRDPQLFLFDEPLSNLDASLRAHMRLEIKKLQR 180 Query: 184 RLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPKDIYNNPANLFVASFIGSPPMNF 243 L T+VYVTHDQ+EAMTL D++ V+ G I+Q GTP ++Y+ PA+ FVASFIGSP MNF Sbjct: 181 ELAVTSVYVTHDQVEAMTLADRIIVLNQGEIEQIGTPAEVYHQPASTFVASFIGSPAMNF 240 Query: 244 IPLRLQRKDGRLLALLDSGQARCELPLGMQDAGLEDREVILGIRPEQIILANGEANGLPT 303 + DG + + + A L + + LGIRPE +L + +GL + Sbjct: 241 HQAEI--ADGVI-------NFEHQSIFIAEYAHLSAQTIQLGIRPEHAVLEPSK-SGL-S 289 Query: 304 IRAEVQVTEPTGPDTLVFVNLNDTKVCCRLAPDVAPAVGETLTLQFDPAKVLLFDAKTGE 363 VQ EP GP+ LV +ND KV L P++ A + LTL + LFD K G+ Sbjct: 290 FSLTVQAVEPLGPNQLVHGLVND-KVFTALTPELHFASKQVLTLHVAKQHLHLFD-KNGQ 347 Query: 364 RLGVAGVPKAEA 375 RL A+A Sbjct: 348 RLQALAQEVAQA 359 Lambda K H 0.319 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 360 Length adjustment: 30 Effective length of query: 356 Effective length of database: 330 Effective search space: 117480 Effective search space used: 117480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory