Align ABC transporter for D-glucosamine, ATPase component (characterized)
to candidate WP_017223414.1 A923_RS0119705 amino acid ABC transporter ATP-binding protein
Query= reanno::pseudo3_N2E3:AO353_21725 (265 letters) >NCBI__GCF_000276805.1:WP_017223414.1 Length = 244 Score = 201 bits (510), Expect = 2e-56 Identities = 106/247 (42%), Positives = 157/247 (63%), Gaps = 7/247 (2%) Query: 15 LLEIRDLHKQYGPLEVLKGVDLTMQRGNVVTLIGSSGSGKTTLLRCVNMLEEFQGGQILL 74 ++++ +L K +G VL+ +DL ++ G +IG SG+GK+TLLRC+N LE I + Sbjct: 1 MIKVANLSKHFGDNVVLRQIDLDIKEGETTVIIGPSGTGKSTLLRCLNFLEHPTSATITI 60 Query: 75 DGESIGYHEVNGKRVRHSEKVIAQHRAMTGMAFQQFNLFPHLTALQNVTLGLLKVKKLHK 134 D + + ++K I R T FQ + LF + TAL+N+T GL+ V+ Sbjct: 61 DDLVVDANSA-------TKKQITALRKKTAFVFQNYALFANKTALENITEGLITVRGKSA 113 Query: 135 DEAVVLAEKWLERVGLLERRDHYPGQLSGGQQQRVAIARAIAMNPSLMLFDEVTSALDPE 194 A A+ L+ +GL +++D+YP LSGGQQQR+ IARA+A ++LFDE TSALDPE Sbjct: 114 VIAKQEAQAILKSIGLADKQDYYPSALSGGQQQRIGIARAMAAQSKVILFDEPTSALDPE 173 Query: 195 LVGEVLSVIKGLAEDGMTMLLVTHEMRFAFEVSDKIVFMNQGRIEEQGPPKELFERPQSP 254 VGEVL +++ LA+ TML+VTHEM+FA E++D+++FM+QG+I EQG +F PQ P Sbjct: 174 WVGEVLGLMRQLAKQKQTMLIVTHEMQFAKEIADRVIFMDQGQIIEQGSADMIFNNPQDP 233 Query: 255 RLAEFLK 261 R FL+ Sbjct: 234 RTRTFLQ 240 Lambda K H 0.319 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 265 Length of database: 244 Length adjustment: 24 Effective length of query: 241 Effective length of database: 220 Effective search space: 53020 Effective search space used: 53020 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory