Align GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate WP_017219776.1 A923_RS0101025 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::G3LHY9 (356 letters) >NCBI__GCF_000276805.1:WP_017219776.1 Length = 360 Score = 211 bits (536), Expect = 3e-59 Identities = 114/308 (37%), Positives = 186/308 (60%), Gaps = 8/308 (2%) Query: 24 SLKEVDHEWNDGGAYALLGPSGCGKTTLLNIISGLLQPSHGRILFDGKDVTNLSTQSRNI 83 ++K V + G L+GPSGCGK+++L I+GL + G I + + + N SR+I Sbjct: 17 AVKGVSVDIKQGEFIVLVGPSGCGKSSILRSIAGLESITGGEIHLNNRRIDNEKPASRDI 76 Query: 84 AQVFQFPVIYDTMTVYDNLAFPLRNRGVAEADVDRRVRDILEMIDLASWARRKAQGLTAD 143 A VFQ +Y MTVY+NLA+ L+NRG+ ++ ++ + + + +A + RK L+ Sbjct: 77 AMVFQNYALYPHMTVYENLAYGLKNRGIDRDTIESKIEKVAKTLKIADYLERKPAKLSGG 136 Query: 144 QKQKISLGRGLVRNDVNAILFDEPLTVIDPHMKWVLRSQLKRLHKQFGFTMVYVTHDQTE 203 Q+Q++++GR +VR D LFDEPL+ +D ++ +R ++K+L ++ T VYVTHDQ E Sbjct: 137 QRQRVAMGRAIVR-DPQLFLFDEPLSNLDASLRAHMRLEIKKLQRELAVTSVYVTHDQVE 195 Query: 204 ALTFAEKVVVMYDGQIVQIGTPAELFERPSHTFVGYFIGSPGMNFMPARIEGSTVKVGDE 263 A+T A++++V+ G+I QIGTPAE++ +P+ TFV FIGSP MNF A I + + Sbjct: 196 AMTLADRIIVLNQGEIEQIGTPAEVYHQPASTFVASFIGSPAMNFHQAEIADGVINFEHQ 255 Query: 264 TLTL-EYAPKTSGTAKTELGIRPEFIRL--GREGM--PITISKVEDIGRQKIVRARFADQ 318 ++ + EYA ++ T +LGIRPE L + G+ +T+ VE +G ++V D+ Sbjct: 256 SIFIAEYAHLSAQT--IQLGIRPEHAVLEPSKSGLSFSLTVQAVEPLGPNQLVHGLVNDK 313 Query: 319 PIAIVVPE 326 + PE Sbjct: 314 VFTALTPE 321 Lambda K H 0.321 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 257 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 360 Length adjustment: 29 Effective length of query: 327 Effective length of database: 331 Effective search space: 108237 Effective search space used: 108237 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory