Align ABC transporter for L-Histidine, permease component 1 (characterized)
to candidate WP_017220928.1 A923_RS0106860 amino acid ABC transporter permease
Query= reanno::acidovorax_3H11:Ac3H11_2554 (222 letters) >NCBI__GCF_000276805.1:WP_017220928.1 Length = 359 Score = 111 bits (277), Expect = 2e-29 Identities = 64/203 (31%), Positives = 114/203 (56%), Gaps = 6/203 (2%) Query: 18 GALVTVEITAASLLLGCVMGLLVGIGRLNPKRRVVYALCTAYVAAIRGTPLLVQLFILFF 77 G ++T+ + A ++ +G+L+ +GR + +V LC ++ IRG PL+ LF+ Sbjct: 152 GLMLTILVAAVGIIASFPIGILLALGRQSDNMPIVKTLCVGFIEFIRGVPLITILFMASV 211 Query: 78 GLPQF---GILLPAFVCGVIGLGIYSGAYVSEVVRGAIQSIDKGQMEAARSIGMSSGLAM 134 LP F GI + +IG+ ++ AY++EV+RG +Q+I KGQ EA+ S+G+S M Sbjct: 212 VLPLFFSDGIEFDKLLRALIGITLFQAAYIAEVIRGGLQAIPKGQYEASESLGLSYWQGM 271 Query: 135 RTVVLPQAVVRMIPPLGNEFIALIKNSALVSLLTIHDLMHEGQKIIS-VSYRSLEV--YL 191 ++LPQA+ IP L FI+L K++ LV ++ + D++ S S+ E+ Y+ Sbjct: 272 ILIILPQALKISIPNLVGSFISLFKDTTLVLIIGLFDILAMVTLTNSDTSWLGFEIEGYV 331 Query: 192 AIAVVYFILTGATTLVLRRIELR 214 + ++Y++ + + R IE R Sbjct: 332 FVTLIYWVFCFSMSQYSRVIERR 354 Lambda K H 0.328 0.143 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 222 Length of database: 359 Length adjustment: 26 Effective length of query: 196 Effective length of database: 333 Effective search space: 65268 Effective search space used: 65268 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory