Align glucokinase (EC 2.7.1.2) (characterized)
to candidate WP_017222012.1 A923_RS0112485 ROK family protein
Query= reanno::SB2B:6937235 (310 letters) >NCBI__GCF_000276805.1:WP_017222012.1 Length = 310 Score = 180 bits (457), Expect = 3e-50 Identities = 108/304 (35%), Positives = 152/304 (50%), Gaps = 13/304 (4%) Query: 5 GIDLGGTKIELVTLNEKGEEVFRKRVPTP-KDYRATLEAVAGLVHDSEKETGQVSSVGIG 63 G D+GGTKIE N E VF +R+P P +DY L+A+ + +++++ VGIG Sbjct: 4 GFDIGGTKIEFSVYNTALECVFNERIPAPTEDYEELLDALDTFIFNADRQFDCKGMVGIG 63 Query: 64 IPGVVSAVTGRVKNSNAVWLNGQPMDKDLGAMLGREVRIANDANCFAVSESVDGGGAGKT 123 PGV+ + N L+GQ + DL + R+V++ NDANCFA+SE G Sbjct: 64 YPGVMDPDSNMTICPNLPSLHGQNLQLDLQKRISRDVKVQNDANCFALSECFKGAAQDAD 123 Query: 124 LVFGAILGTGCGAGIAINHKVHGGGNGIGGEWGHNPLPWMTAD---EFNSTRCFCGNADC 180 + LGTG G I IN + G N GE+GH +P E T C CG C Sbjct: 124 IAIAVTLGTGLGGAICINKTILSGHNFGAGEFGHMAIPGTMLQRYPELPLTHCGCGGHSC 183 Query: 181 IETFVSGTGFVR---------DFRAHGGEAASGIEIVALMGKGEPLAEAAFGRFIDRLAR 231 +ET+ SGTG D + +A G I+A EP+A F+D LA Sbjct: 184 LETYCSGTGLAALYKHYKIHIDGSCNEEQALKGPAIIAAYTANEPVAIKTVTVFLDILAA 243 Query: 232 ALAHVINLLDPDVIVLGGGVSNIDEIYEYLPALLPKYVLGGECATKVVKNHHGASSGVRG 291 AL ++I +LDP+V+V GGG++ D +Y LP + YV ++ + G GVRG Sbjct: 244 ALGNLIMILDPNVVVFGGGLARFDALYSQLPERIKAYVFDNMKLPQLKQAAFGGEGGVRG 303 Query: 292 AAWL 295 AA L Sbjct: 304 AALL 307 Lambda K H 0.318 0.138 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 299 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 310 Length of database: 310 Length adjustment: 27 Effective length of query: 283 Effective length of database: 283 Effective search space: 80089 Effective search space used: 80089 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory