Align 3-ketoacyl-CoA thiolase, mitochondrial; Acetyl-CoA acetyltransferase; Acetyl-CoA acyltransferase; Acyl-CoA hydrolase, mitochondrial; Beta-ketothiolase; Mitochondrial 3-oxoacyl-CoA thiolase; EC 2.3.1.16; EC 2.3.1.9; EC 3.1.2.-; EC 3.1.2.1; EC 3.1.2.2 (characterized)
to candidate WP_017223546.1 A923_RS0120390 acetyl-CoA C-acetyltransferase
Query= SwissProt::P13437 (397 letters) >NCBI__GCF_000276805.1:WP_017223546.1 Length = 426 Score = 165 bits (417), Expect = 3e-45 Identities = 127/433 (29%), Positives = 196/433 (45%), Gaps = 55/433 (12%) Query: 4 LRGVFIVAAKRTPFGAYGGLLKDFTATDLTEFAARAALSAGKVPPETIDSVIVGNVMQSS 63 +R V I+ R PF + D+ R + + E + V+ G V++ S Sbjct: 6 IRRVAIIGGNRIPFARSNTAYSKLSNQDMLTETIRGLVVKYNLRGEQLGEVVAGAVIKHS 65 Query: 64 SDAAYLARHVGLRVGVPTETGALTLNRLCGSGFQSIVSGCQEICSKDAEVVLCGGTESMS 123 D L R L G+ ET + + CG+G + + +I E + GG+++ S Sbjct: 66 RDFN-LTREAVLSAGLAPETPCYDIQQACGTGLAAAIQVANKIALGQIEAGIAGGSDTTS 124 Query: 124 QSPYSV----RNV------------RFGTKFGLDLKLEDTLWAGLTDQHVKLPMGMTAEN 167 +P +V R+V R L LK L + K+ MG + Sbjct: 125 DAPIAVSEGMRSVLLELNRAKTGKQRLKALSRLRLKHFAPLTPANKEPRTKMAMGDHCQV 184 Query: 168 LAAKYNISREDCDRYALQSQQRWKAANEAGYFNEEMAPIEVKTKKGKQTMQVDEHARPQT 227 A ++NISRE D A S Q+ AA E G+F+ ++P+ TK D R T Sbjct: 185 TAKEWNISREAQDALACASHQKLAAAYEEGFFDTLVSPMAGLTK--------DNVLRADT 236 Query: 228 TLEQLQNLPPVFKK-EGTVTAGNASGMSDGAGVVIIASEDAVKKHNFTPLARVVGYFVSG 286 T+E+L L P F K GT+TAGN++ ++DGA V++ASE+ HN V Y G Sbjct: 237 TVEKLAKLKPCFDKVNGTMTAGNSTNLTDGASAVLLASEEWAAAHNLP----VQAYLTFG 292 Query: 287 CDPAI--------MGIGPVPAITGALKKAGLSLKDMDLIDVNEAFAPQFLAVQKSLD--- 335 AI + + P A+ LK+AGL+L+D D +++EAFA Q L+ + + Sbjct: 293 ETAAIDFVDKKEGLLMAPAYAVPKMLKRAGLTLQDFDYYEIHEAFAAQVLSTLAAWEDEK 352 Query: 336 --------------LDPSKTNVSGGAIALGHPLGGSGSRITAHLVHELRRRGGKYAVGSA 381 +D +K NV G ++A GHP +G R+ A L L ++G + S Sbjct: 353 FCKEKLGLDAALGSIDMTKLNVKGSSLATGHPFAATGGRVVATLAQLLDQKGSGRGLISI 412 Query: 382 CIGGGQGISLIIQ 394 C GGQGI+ I++ Sbjct: 413 CAAGGQGITAILE 425 Lambda K H 0.317 0.133 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 369 Number of extensions: 24 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 426 Length adjustment: 31 Effective length of query: 366 Effective length of database: 395 Effective search space: 144570 Effective search space used: 144570 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory